22-2895, Peptide report created on 05/10/2022 Experiment: 22-2895 Peak List Generator: unknown Version: unknown Charge States Calculated: unknown Deisotoped: unknown Textual Annotation: unknown Database Set: 1 Database Database Name: the uniprot-SP-Mus-musculus_20190417_20200629 database Version: unknown Taxonomy: All Entries Number of Proteins: 17009 Does database contain common contaminants?: unknown Search Engine Set: 1 Search Engine Search Engine: Mascot Version: 2.8.0 Samples: All Samples Fragment Tolerance: 0.60 Da (Monoisotopic) Parent Tolerance: 10.0 PPM (Monoisotopic) Fixed Modifications: +57 on C (Carbamidomethyl) Variable Modifications: +1 on NQ (Deamidated), +16 on M (Oxidation), +42 on Peptide N-Terminal (Acetyl) Database: the uniprot-SP-Mus-musculus_20190417_20200629 database (unknown version, 17009 entries) Digestion Enzyme: Trypsin Max Missed Cleavages: 3 Probability Model: 20220411_bbm1840_22-2895_Killinger_9 (F006909): Peptide Prophet with Delta Mass Correction [+1,+2,+3 and above] 20220411_bbm1840_22-2895_Killinger_15 (F006911): Peptide Prophet with Delta Mass Correction [+1,+2,+3 and above] 20220411_bbm1840_22-2895_Killinger_12 (F006910): Peptide Prophet with Delta Mass Correction [+1,+2,+3 and above] 20220411_bbm1840_22-2895_Killinger_18 (F006912): Peptide Prophet with Delta Mass Correction [+1,+2,+3 and above] Scaffold: Version: Scaffold_5.1.2 Modification Metadata Set: 2334 modifications Source: C:\Program Files\Scaffold\parameters\unimod.xml Comment: Protein Grouping Strategy: Experiment-wide grouping with binary peptide-protein weights Peptide Thresholds: 95.0% minimum Protein Thresholds: 98.0% minimum and 1 peptide minimum Peptide FDR: 0.0% (Decoy) Protein FDR: 0.4% (Decoy) GO Annotation Source(s): Pathway Annotation Source(s): Alternate ID Source(s): FASTA:UniProt/Swiss-Prot (UniProtKB) Experiment name Biological sample category Biological sample name MS/MS sample name Protein name Protein accession numbers Alternate IDs Database sources Protein molecular weight (Da) Protein identification probability Exclusive unique peptide count Exclusive unique spectrum count Exclusive spectrum count Percentage of total spectra Percentage sequence coverage Peptide sequence Previous amino acid Next amino acid Best Peptide identification probability Best Mascot Ion Score Best Mascot Identity Score Best Mascot Homology Score Best Mascot Delta Ion Score Number of identified +1H spectra Number of identified +2H spectra Number of identified +3H spectra Number of identified +4H spectra Number of enzymatic termini Calculated +1H Peptide Mass (AMU) Median Retention Time Total Precursor Intensity Total TIC Peptide start index Peptide stop index Star Category Assigned Other Proteins 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Quinone oxidoreductase-like protein 2 OS=Mus musculus OX=10090 GN=Cryzl2 PE=1 SV=1 Q3UNZ8 Cryzl2 uniprot_Mus-musculus_SP.fasta 37,808.2 98.5% 1 1 1 0.00380% 4.00% GAQFSVNYSQGSLR R D 99.7% 40.4 25.0 0.000 40.4 0 1 0 0 2 1,513.7393 2,699.56 12,382.4 209 222 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% AHGFTFTR R G 94.7% 26.2 25.0 0.000 26.2 0 1 0 0 2 936.4686 1,972.77 78,481.8 120 127 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% AILAELTGR R R 99.7% 43.5 25.0 16.9 32.7 0 2 0 0 2 943.5572 3,042.60 93,569.9 133 141 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% LEEGPPVTTVLTR R E 99.7% 66.7 25.0 16.0 64.4 0 1 0 0 2 1,411.7793 2,978.71 38,475.1 46 58 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% NFYGGNGIVGAQVPLGAGIALACK K Y 99.2% 26.1 27.9 0.000 2.22 0 0 1 0 2 2,348.2070 4,214.39 17,545.2 159 182 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% TREEIQEVR R S 99.7% 39.7 26.1 25.4 25.1 0 2 0 0 2 1,159.6066 1,257.42 60,779.3 303 311 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 100.0% 6 6 9 0.0342% 19.7% YHGHSMSDPGVSYR R T 99.7% 39.2 25.0 0.000 39.2 0 0 2 0 2 1,608.6860 1,212.99 92,745.3 289 302 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Mitogen-activated protein kinase 1 OS=Mus musculus OX=10090 GN=Mapk1 PE=1 SV=3 P63085 Mapk1 uniprot_Mus-musculus_SP.fasta 41,277.9 98.6% 1 1 1 0.00380% 5.31% VADPDHDHTGFLTEYVATR R W 99.7% 39.5 25.7 0.000 39.5 0 0 1 0 2 2,144.0045 2,983.10 32,147.1 171 189 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Vesicle-associated membrane protein 2 OS=Mus musculus OX=10090 GN=Vamp2 PE=1 SV=2 P63044 Vamp2 uniprot_Mus-musculus_SP.fasta 12,691.1 98.6% 1 1 3 0.0114% 20.7% LSELDDRADALQAGASQFETSAAK K L 99.7% 47.0 28.1 13.1 46.8 0 0 3 0 2 2,494.2058 3,200.99 50,339.0 60 83 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% AILVDLEPGTMDSVR R S 99.7% 56.8 27.0 17.6 53.6 0 3 0 0 2 1,631.8312 3,227.20 70,835.4 63 77 Empty true P99024,Q9ERD7 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% ALTVPELTQQMFDSK R N 99.7% 60.9 26.7 0.000 59.1 0 2 0 0 2 1,723.8574 3,293.30 48,401.1 283 297 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% EIVHIQAGQCGNQIGAK R F 99.7% 52.7 27.3 14.9 0.000 0 0 2 0 2 1,822.9231 2,120.32 78,971.5 3 19 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% EVDEQMLNVQNK K N 99.7% 69.0 25.0 18.3 63.5 0 2 0 0 2 1,462.6844 1,719.98 31,735.0 325 336 Empty true P99024,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% GHYTEGAELVDSVLDVVR K K 99.7% 111 27.2 31.3 89.4 0 3 2 0 2 1,958.9819 4,497.05 765490 104 121 Empty true P99024,Q9ERD7,Q922F4,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% GHYTEGAELVDSVLDVVRK K E 99.7% 73.9 27.8 19.5 71.6 0 0 4 0 2 2,087.0769 4,245.10 160394 104 122 Empty true P99024,Q9ERD7,Q922F4,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% IMNTFSVMPSPK R V 99.7% 47.5 25.0 18.7 38.4 0 1 0 0 2 1,383.6648 2,232.44 56,747.3 163 174 Empty true Q922F4 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% INVYYNEAAGNK R Y 99.7% 61.9 25.0 0.000 57.5 0 3 0 0 2 1,355.6589 2,142.96 229557 47 58 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% IREEYPDR K I 99.0% 40.2 25.4 21.1 32.4 0 2 0 0 2 1,077.5324 1,205.08 199100 155 162 Empty true P99024,Q922F4,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% ISEQFTAMFR R R 99.7% 75.5 25.0 16.4 63.5 0 5 0 0 2 1,245.5933 2,920.93 1302230 381 390 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% LHFFMPGFAPLTSR R G 99.7% 47.1 27.0 15.9 37.7 0 6 2 0 2 1,620.8356 4,009.55 417952 263 276 Empty true P99024,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% LTTPTYGDLNHLVSATMSGVTTCLR K F 99.7% 80.8 28.1 15.4 79.9 0 0 7 0 2 2,724.3334 3,991.65 211238 217 241 Empty true P99024,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% MREIVHIQAGQCGNQIGAK - F 99.7% 56.1 27.4 16.1 0.000 0 0 4 0 2 2,126.0596 1,998.24 274344 1 19 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% MSATFIGNSTAIQELFK K R 99.7% 125 27.2 15.8 0.000 0 4 0 0 2 1,873.9366 4,434.16 79,070.1 363 379 Empty true P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% MSATFIGNSTAIQELFKR K I 99.7% 44.1 27.5 13.1 6.63 0 0 3 0 2 2,031.0217 4,213.44 144624 363 380 Empty true P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% MSMKEVDEQMLNVQNK R N 99.7% 43.3 25.0 13.1 43.3 0 0 2 0 2 1,971.8822 1,605.46 117982 321 336 Empty true P99024,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% NSSYFVEWIPNNVK K T 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% RISEQFTAMFR K R 97.2% 29.1 25.7 16.9 23.2 0 1 0 0 2 1,401.6944 2,652.18 41,506.3 380 390 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 72.2 27.8 16.7 4.09 0 0 10 0 2 2,799.3276 4,391.44 245757 78 103 Empty true P99024,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% TAVCDIPPR K G 99.7% 71.4 25.0 21.4 66.1 0 9 0 0 2 1,028.5195 1,861.72 880467 351 359 Empty true P99024,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 26 39 101 0.384% 60.9% YLTVAAIFR R G 99.7% 51.5 25.0 0.000 49.8 0 2 0 0 2 1,053.6091 3,938.21 153088 310 318 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) T-complex protein 1 subunit beta OS=Mus musculus OX=10090 GN=Cct2 PE=1 SV=4 P80314 Cct2 uniprot_Mus-musculus_SP.fasta 57,478.8 98.6% 1 1 3 0.0114% 2.80% QVLLSAAEAAEVILR R V 99.7% 69.0 25.0 0.000 69.0 0 3 0 0 2 1,582.9163 4,664.67 33,207.4 502 516 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% ALMLQGVDLLADAVAVTMGPK R G 99.7% 51.2 25.5 0.000 51.2 0 0 8 0 2 2,113.1399 5,917.19 48,132.1 38 58 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% GVMLAVDAVIAELKK R Q 98.5% 19.1 25.0 13.1 8.79 0 0 1 0 2 1,572.9032 4,383.22 17,267.9 143 157 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% ISSVQSIVPALEIANAHR K K 99.7% 43.7 25.0 13.3 43.7 0 0 3 0 2 1,905.0552 3,728.29 107963 251 268 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% KPLVIIAEDVDGEALSTLVLNR R L 99.7% 24.9 25.0 0.000 24.9 0 0 1 0 2 2,365.3340 4,600.46 13,852.7 269 290 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% TLNDELEIIEGMKFDR K G 99.7% 33.1 27.3 13.5 30.3 0 0 1 0 2 1,922.9531 4,197.80 20,764.3 206 221 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 6 6 17 0.0646% 17.6% VTDALNATR R A 99.7% 40.3 25.1 16.9 35.1 0 3 0 0 2 960.5109 1,423.73 131234 421 429 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% ARFEELNADLFR R G 99.7% 51.7 25.7 20.9 43.6 0 0 3 0 2 1,480.7543 3,376.08 117311 300 311 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% DAGTIAGLNVLR K I 99.7% 73.6 25.0 19.5 58.8 0 1 0 0 2 1,199.6744 3,339.69 100369 160 171 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% GPAVGIDLGTTYSCVGVFQHGK K V 99.7% 31.2 28.3 0.000 31.2 0 0 3 0 2 2,263.1179 3,563.21 139356 4 25 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% IINEPTAAAIAYGLDKK R V 99.7% 27.5 25.0 18.6 25.6 0 0 2 0 2 1,787.9904 3,278.28 200840 172 188 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% LDKSQIHDIVLVGGSTR K I 99.7% 48.8 25.0 13.3 48.8 0 0 2 0 2 1,838.0133 2,764.63 139351 326 342 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% LLQDFFNGKELNK K S 99.7% 29.0 25.6 14.6 1.68 0 0 2 0 2 1,566.8165 3,405.68 123240 349 361 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% LSKEDIER R M 95.6% 33.2 26.0 26.3 10.1 0 2 0 0 2 989.5263 1,245.26 86,606.6 510 517 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% MVQEAEKYKAEDEKQR R D 98.2% 21.3 26.8 13.3 13.8 0 0 1 0 2 1,997.9599 1,005.82 6,240.60 518 533 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% NQVAMNPTNTVFDAK K R 99.7% 74.7 25.6 13.3 58.9 0 2 0 0 2 1,665.7902 2,382.34 18,477.3 57 71 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% STAGDTHLGGEDFDNR K M 99.7% 41.7 25.0 0.000 39.4 0 0 2 0 2 1,691.7258 1,891.12 145140 221 236 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 100.0% 11 11 22 0.0836% 24.9% TTPSYVAFTDTER R L 99.7% 61.0 25.0 21.3 60.2 0 2 0 0 2 1,487.7013 2,753.46 67,692.2 37 49 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1 P63011 Rab3a uniprot_Mus-musculus_SP.fasta 24,970.3 100.0% 4 4 7 0.0266% 23.2% ILIIGNSSVGK K T 99.6% 37.1 25.0 13.5 0.000 0 2 0 0 2 1,100.6675 2,724.09 151948 25 35 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1 P63011 Rab3a uniprot_Mus-musculus_SP.fasta 24,970.3 100.0% 4 4 7 0.0266% 23.2% LVDVICEK R M 99.0% 35.2 26.4 21.0 24.2 0 1 0 0 2 975.5181 2,233.27 51,201.0 179 186 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1 P63011 Rab3a uniprot_Mus-musculus_SP.fasta 24,970.3 100.0% 4 4 7 0.0266% 23.2% MSESLDTADPAVTGAK K Q 99.7% 98.3 25.0 13.7 94.6 0 2 0 0 2 1,608.7424 2,015.09 27,972.9 187 202 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-3A OS=Mus musculus OX=10090 GN=Rab3a PE=1 SV=1 P63011 Rab3a uniprot_Mus-musculus_SP.fasta 24,970.3 100.0% 4 4 7 0.0266% 23.2% QLADHLGFEFFEASAK R D 99.6% 26.9 26.9 13.2 22.3 0 0 2 0 2 1,809.8807 3,979.57 69,648.8 152 167 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synapsin-2 OS=Mus musculus OX=10090 GN=Syn2 PE=1 SV=2 Q64332 Syn2 uniprot_Mus-musculus_SP.fasta 63,373.4 100.0% 2 2 3 0.0114% 4.10% SFRPDFVLIR R Q 98.8% 22.8 25.0 21.4 16.4 0 0 1 0 2 1,249.7052 3,482.12 15,000.5 178 187 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synapsin-2 OS=Mus musculus OX=10090 GN=Syn2 PE=1 SV=2 Q64332 Syn2 uniprot_Mus-musculus_SP.fasta 63,373.4 100.0% 2 2 3 0.0114% 4.10% VLLVVDEPHTDWAK K C 99.7% 30.8 26.4 0.000 21.5 0 0 2 0 2 1,621.8586 3,159.36 81,355.7 116 129 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) T-complex protein 1 subunit zeta OS=Mus musculus OX=10090 GN=Cct6a PE=1 SV=3 P80317 Cct6a uniprot_Mus-musculus_SP.fasta 58,005.5 99.9% 1 2 3 0.0114% 3.20% AQLGVQAFADALLIIPK R V 99.7% 55.6 25.0 13.2 55.6 0 1 2 0 2 1,768.0370 5,294.17 16,400.7 433 449 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Importin-5 OS=Mus musculus OX=10090 GN=Ipo5 PE=1 SV=3 Q8BKC5 Ipo5 uniprot_Mus-musculus_SP.fasta 123,593.6 99.8% 1 1 2 0.00760% 1.73% QLALEVIVTLSETAAAMLR R K 99.7% 57.4 25.0 14.3 51.7 0 0 2 0 2 2,029.1363 6,564.74 24,698.3 277 295 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% ACALSIAESCRPGDKVPSIK R A 98.0% 23.8 27.7 13.3 23.0 0 0 2 0 2 2,159.0950 2,686.48 97,598.2 466 485 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% AKNTVIATGGYGR R T 95.3% 36.7 25.0 0.000 35.3 0 1 0 0 2 1,307.7067 1,598.45 17,211.4 249 261 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% ANAGEESVMNLDKLR K F 97.8% 22.3 26.6 18.5 21.0 0 0 2 0 2 1,662.8117 2,500.50 80,916.2 486 500 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% ISQLYGDLK K H 99.7% 48.0 25.0 20.7 37.2 0 2 0 0 2 1,036.5675 2,467.10 119577 539 547 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% LGANSLLDLVVFGR R A 99.7% 98.4 25.0 13.7 98.4 0 2 0 0 2 1,473.8425 5,130.02 47,569.3 452 465 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% TGHSLLHTLYGR R S 99.7% 29.5 25.0 13.1 27.3 0 0 2 0 2 1,354.7227 2,458.07 155892 196 207 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 7 7 13 0.0494% 14.2% VGSVLQEGCEK R I 99.7% 76.8 25.3 13.9 72.6 0 2 0 0 2 1,205.5832 1,660.34 85,262.3 528 538 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus OX=10090 GN=Slc25a11 PE=1 SV=3 Q9CR62 Slc25a11 uniprot_Mus-musculus_SP.fasta 34,156.3 98.6% 1 1 1 0.00380% 3.18% LGIYTVLFER R L 99.7% 71.6 25.0 0.000 67.6 0 1 0 0 2 1,210.6831 4,283.50 17,664.1 99 108 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase C OS=Mus musculus OX=10090 GN=Aldoc PE=1 SV=4 P05063 Aldoc uniprot_Mus-musculus_SP.fasta 39,395.5 100.0% 2 2 4 0.0152% 9.64% ISDRTPSALAILENANVLAR K Y 99.7% 41.9 25.0 14.6 41.3 0 0 2 0 2 2,124.1772 4,271.48 61,328.6 154 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase C OS=Mus musculus OX=10090 GN=Aldoc PE=1 SV=4 P05063 Aldoc uniprot_Mus-musculus_SP.fasta 39,395.5 100.0% 2 2 4 0.0152% 9.64% RLSQIGVENTEENRR K L 99.4% 23.9 26.8 13.0 19.9 0 0 2 0 2 1,800.9311 1,609.86 66,570.0 43 57 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 10 0.0380% 8.07% ALEESNYELEGK R I 99.7% 96.2 25.0 17.6 88.9 0 3 0 0 2 1,381.6482 2,142.81 201246 164 175 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 10 0.0380% 8.07% QSLEASLAETEGR K Y 99.7% 101 26.2 15.7 89.0 0 2 0 0 2 1,390.6809 2,667.11 84,545.0 385 397 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 10 0.0380% 8.07% QSVEADINGLRR R V 99.7% 28.4 26.7 21.5 11.6 0 0 5 0 2 1,358.7024 2,393.19 441071 244 255 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 10 0.0380% 8.07% VTMQNLNDR R L 99.7% 72.7 25.0 24.7 0.000 0 3 0 0 2 1,106.5260 1,009.20 352278 146 154 Empty false Q9Z2K1,Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% AHIAQLCEK R A 99.3% 34.5 25.0 17.4 31.8 0 2 0 0 2 1,069.5460 1,338.83 52,149.7 611 619 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% AHMGMFTELAILYSK R F 99.3% 23.5 26.1 17.4 3.06 0 0 2 0 2 1,711.8547 4,274.46 34,949.9 1312 1326 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% AHTMTDDVTFWK K W 99.1% 33.5 25.0 13.1 33.5 0 1 0 0 2 1,467.6575 2,674.71 18,032.9 101 112 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% ALEHFTDLYDIKR R A 99.7% 66.7 26.5 16.3 60.6 0 0 2 0 2 1,620.8382 2,970.03 126523 626 638 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% ARESYVETELIFALAK K T 99.7% 65.2 25.5 13.4 60.6 0 0 2 0 2 1,839.9851 4,273.48 36,750.9 1164 1179 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% EGQFKDIITK K V 97.3% 28.4 25.1 19.6 26.0 0 1 0 0 2 1,178.6418 2,191.59 38,714.8 1388 1397 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% ESYVETELIFALAK R T 99.7% 64.1 25.8 13.5 63.4 0 2 0 0 2 1,612.8469 4,622.53 41,916.1 1166 1179 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% FLRENPYYDSR R V 99.7% 35.5 25.0 14.6 28.7 0 0 2 0 2 1,459.6964 2,145.05 272787 893 903 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% HSSLAGCQIINYR R T 99.7% 36.4 26.5 0.000 35.6 0 1 2 0 2 1,518.7482 2,445.47 118453 145 157 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% ISGETIFVTAPHEATAGIIGVNR R K 99.7% 100 26.7 0.000 99.2 0 0 2 0 2 2,353.2512 3,641.42 137152 298 320 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% IVLDNSVFSEHR K N 99.7% 63.7 25.9 13.3 61.3 0 2 2 0 2 1,415.7277 2,824.23 243309 1011 1022 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% IYIDSNNNPER K F 99.7% 71.9 25.0 21.6 58.8 0 6 0 0 2 1,334.6335 1,827.82 263685 882 892 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% KFDVNTSAVQVLIEHIGNLDR R A 99.7% 71.9 25.7 13.2 71.9 0 0 2 0 2 2,368.2621 4,797.75 71,037.6 1074 1094 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% KFNALFAQGNYSEAAK R V 99.7% 41.3 27.0 13.1 41.3 0 0 1 0 2 1,758.8809 2,794.96 79,007.4 367 382 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% KVGYTPDWIFLLR K N 99.6% 28.6 25.0 14.7 19.7 0 0 2 0 2 1,607.8946 4,493.09 34,544.0 507 519 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% LAELEEFINGPNNAHIQQVGDR R C 99.7% 38.8 28.3 14.6 37.6 0 0 2 0 2 2,464.2217 3,566.79 68,170.9 1183 1204 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% LASTLVHLGEYQAAVDGAR R K 99.7% 58.5 26.9 13.0 56.8 0 0 3 0 2 1,971.0295 3,276.10 415035 1227 1245 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% LHIIEVGTPPTGNQPFPK K K 99.7% 35.3 25.4 13.3 34.9 0 0 2 0 2 1,945.0545 3,143.82 126043 228 245 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% LLLPWLEAR K I 99.7% 46.8 25.0 23.4 40.8 0 2 0 0 2 1,110.6671 4,459.20 43,109.4 857 865 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% LLYNNVSNFGR K L 99.7% 67.4 25.4 14.6 67.4 0 2 0 0 2 1,296.6694 2,900.64 269890 1216 1226 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% NLQNLLILTAIK R A 99.7% 51.4 25.0 16.8 46.4 0 2 0 0 2 1,353.8466 4,536.96 57,635.7 1023 1034 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% NLQNLLILTAIKADR R T 99.7% 30.1 25.0 14.2 27.8 0 0 2 0 2 1,696.0118 4,296.08 47,061.7 1023 1037 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% NNRPSEGPLQTR K L 99.7% 53.7 25.2 18.6 48.5 0 1 3 0 2 1,368.6979 1,280.83 188914 572 583 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% RDPHLACVAYER K G 97.6% 20.9 25.0 13.1 20.9 0 0 1 0 2 1,486.7220 1,782.84 117424 912 923 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% RPLIDQVVQTALSETQDPEEVSVTVK R A 99.7% 56.6 26.4 15.0 56.6 0 0 3 0 2 2,881.5156 4,571.38 37,819.0 968 993 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% SVDPTLALSVYLR K A 99.7% 87.3 25.0 13.1 87.3 0 2 0 0 2 1,433.7999 4,210.86 109211 469 481 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% SVNESLNNLFITEEDYQALR K T 99.3% 27.0 27.7 0.000 27.0 0 0 1 0 2 2,355.1463 4,243.62 17,871.9 1462 1481 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% TGQIKEVER K I 98.6% 32.9 25.7 26.8 18.4 0 1 0 0 2 1,059.5794 972.532 25,271.8 738 746 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% TLQIFNIEMK K S 99.7% 51.7 25.0 15.8 38.1 0 2 0 0 2 1,252.6608 3,446.74 135662 87 96 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% TWKEVCFACVDGK R E 99.7% 33.4 25.0 16.8 32.4 0 0 2 0 2 1,599.7296 2,843.44 105103 1252 1264 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% VGYTPDWIFLLR K N 99.7% 55.9 25.0 22.5 49.0 0 2 0 0 2 1,479.7996 4,958.92 32,710.6 508 519 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 32 37 69 0.262% 24.9% VIQCFAETGQVQK K I 99.7% 48.8 26.1 19.6 46.6 0 2 0 0 2 1,507.7575 2,213.60 52,994.1 488 500 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) PHD finger protein 24 OS=Mus musculus OX=10090 GN=Phf24 PE=1 SV=2 Q80TL4 Phf24 uniprot_Mus-musculus_SP.fasta 45,222.4 98.6% 1 1 2 0.00760% 3.00% ALTDEQEEQAAR R Q 99.7% 46.3 25.0 13.2 46.3 0 2 0 0 2 1,360.6340 1,396.59 34,878.3 239 250 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin-related protein 3B OS=Mus musculus OX=10090 GN=Actr3b PE=1 SV=1 Q641P0,Q99JY9 Actr3,Actr3b uniprot_Mus-musculus_SP.fasta 47,580.0 98.6% 1 1 1 0.00380% 2.63% DITYFIQQLLR R E 99.7% 48.0 25.0 13.2 35.7 0 1 0 0 2 1,409.7789 5,624.93 9,639.80 199 209 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Trifunctional enzyme subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Hadhb PE=1 SV=1 Q99JY0 Hadhb uniprot_Mus-musculus_SP.fasta 51,388.0 99.7% 1 1 3 0.0114% 4.42% TNIPKDVVDYIIFGTVIQEVK R T 99.4% 25.3 25.0 17.3 25.2 0 0 3 0 2 2,391.3173 5,269.00 16,523.1 92 112 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hemoglobin subunit alpha OS=Mus musculus OX=10090 GN=Hba PE=1 SV=2 P01942 Hba uniprot_Mus-musculus_SP.fasta 15,085.4 99.1% 1 1 2 0.00760% 10.6% IGGHGAEYGAEALER K M 99.7% 39.0 25.0 16.0 32.5 0 0 2 0 2 1,529.7344 2,137.92 136627 18 32 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% FLSQIESDR K L 99.6% 37.9 25.2 22.3 34.0 0 2 0 0 2 1,094.5477 2,306.30 85,061.6 842 850 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% FLSQIESDRLALLQVR K A 99.7% 29.5 25.0 20.1 27.7 0 0 2 0 2 1,888.0652 3,836.92 191461 842 857 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% GKFTTSDVAAIETDKEGVQNAK R E 99.7% 49.8 27.9 15.2 48.6 0 0 5 0 2 2,309.1622 2,389.62 170946 388 409 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% HIDLVEGDEGR R M 99.5% 38.7 25.0 14.8 38.7 0 3 0 0 2 1,239.5966 1,856.15 121234 300 310 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% LSDEILIDILTR R F 99.7% 79.5 25.0 16.4 64.1 0 2 0 0 2 1,400.7998 4,974.56 48,085.4 87 98 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% SANLVAATLGAILNR R L 99.7% 81.0 25.0 0.000 77.6 0 2 2 0 2 1,483.8591 5,166.23 46,727.6 438 452 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 100.0% 7 8 19 0.0722% 10.1% SIPDGTEHGDFLALDLGGTNFR R V 98.3% 20.9 27.2 13.0 20.9 0 0 1 0 2 2,332.1208 3,972.84 23,169.7 574 595 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Stress-70 protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspa9 PE=1 SV=3 P38647 Hspa9 uniprot_Mus-musculus_SP.fasta 73,462.1 100.0% 3 3 7 0.0266% 4.86% AQFEGIVTDLIKR R T 99.7% 30.5 25.0 16.1 25.5 0 0 2 0 2 1,489.8375 3,819.64 100167 349 361 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Stress-70 protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspa9 PE=1 SV=3 P38647 Hspa9 uniprot_Mus-musculus_SP.fasta 73,462.1 100.0% 3 3 7 0.0266% 4.86% VLENAEGAR K T 99.5% 35.8 25.0 14.1 32.0 0 2 0 0 2 958.4952 1,080.20 51,645.9 77 85 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Stress-70 protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspa9 PE=1 SV=3 P38647 Hspa9 uniprot_Mus-musculus_SP.fasta 73,462.1 100.0% 3 3 7 0.0266% 4.86% VQQTVQDLFGR K A 99.7% 69.2 26.8 15.7 59.9 0 3 0 0 2 1,290.6802 3,038.29 123155 395 405 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Thiosulfate sulfurtransferase OS=Mus musculus OX=10090 GN=Tst PE=1 SV=3 P52196 Tst uniprot_Mus-musculus_SP.fasta 33,465.9 100.0% 3 3 5 0.0190% 13.8% ATLNLSLLK K T 99.7% 78.9 25.0 21.4 68.7 0 2 0 0 2 972.6089 3,430.51 56,872.0 155 163 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Thiosulfate sulfurtransferase OS=Mus musculus OX=10090 GN=Tst PE=1 SV=3 P52196 Tst uniprot_Mus-musculus_SP.fasta 33,465.9 100.0% 3 3 5 0.0190% 13.8% TYEQVLENLQSKR K F 99.6% 25.6 26.6 16.3 17.6 0 0 1 0 2 1,607.8388 3,143.70 46,202.2 164 176 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Thiosulfate sulfurtransferase OS=Mus musculus OX=10090 GN=Tst PE=1 SV=3 P52196 Tst uniprot_Mus-musculus_SP.fasta 33,465.9 100.0% 3 3 5 0.0190% 13.8% YLGTQPEPDIVGLDSGHIR R G 99.7% 54.2 27.4 17.7 53.7 0 0 2 0 2 2,067.0509 3,184.10 145228 188 206 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 3 5 12 0.0456% 21.4% ITVVGVGAVGMACAISILMK K D 99.7% 82.6 25.0 0.000 82.6 0 2 4 0 2 1,990.0900 5,742.76 74,496.4 23 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 3 5 12 0.0456% 21.4% LKGYTSWAIGLSVADLAESIMK K N 98.3% 21.3 26.8 13.1 21.3 0 0 2 0 2 2,353.2474 5,638.61 9,957.60 244 265 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 3 5 12 0.0456% 21.4% LLIVSNPVDILTYVAWK K I 99.7% 44.0 25.0 0.000 43.7 0 1 3 0 2 1,944.1206 5,496.88 21,123.0 133 149 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 3 5 12 0.0456% 21.4% VIGSGCNLDSAR R F 99.7% 72.7 25.3 17.1 61.8 0 2 0 0 2 1,248.6002 1,729.89 62,455.2 158 169 Empty false P16125 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% AAGAEEYAQQEVVKR K S 99.7% 32.5 27.2 14.4 31.1 0 0 1 0 2 1,648.8289 1,989.84 66,980.6 261 275 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% AGQVFLEELGNHK K A 97.9% 26.8 25.2 15.1 24.5 0 0 2 0 2 1,441.7435 2,995.79 89,765.2 204 216 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% AHVTLGCAADVQPVQTGLDLLDILQQVK R G 99.7% 49.3 25.6 13.0 47.1 0 0 3 0 2 3,002.5985 5,378.65 12,401.0 328 355 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% GGSQGEAVGELPR K G 99.7% 69.7 25.0 13.1 47.5 0 2 0 0 2 1,256.6231 1,950.14 88,827.9 356 368 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% KAGQVFLEELGNHK R A 99.7% 27.7 26.0 0.000 27.7 0 0 2 0 2 1,569.8385 2,861.55 120111 203 216 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% LSISALFVTPK K T 99.7% 61.3 25.0 0.000 57.0 0 3 0 0 2 1,175.7035 4,125.12 66,795.3 283 293 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 7 7 14 0.0532% 21.9% RPPGVLHCTTK K F 99.7% 29.4 25.2 18.3 20.6 0 0 1 0 2 1,265.6785 1,101.87 49,784.5 244 254 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 173 181 Empty true Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% KLLEGEECR R L 99.7% 42.7 25.8 13.4 42.7 0 2 0 0 2 1,133.5621 1,313.69 83,972.0 466 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% LLEGEECR K L 99.0% 53.4 25.0 26.3 41.6 0 2 0 0 2 1,005.4671 1,410.53 158728 467 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% LRSEIDNVKK R Q 99.7% 36.2 26.0 27.6 1.60 0 0 2 0 2 1,201.6900 1,118.15 393269 390 399 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% NKYEDEINKR K T 99.7% 50.2 25.0 21.4 35.4 0 2 2 0 2 1,308.6543 1,374.03 298665 250 259 Empty true Q8VED5,Q6IFZ6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% SLDLDSIIAEVK R A 99.7% 92.8 25.8 24.6 79.4 0 3 0 0 2 1,302.7153 4,357.57 106858 326 337 Empty true P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% SRTEAESWYQTK R Y 99.7% 43.2 25.0 16.1 40.9 0 2 0 0 2 1,485.6968 1,937.56 19,592.9 347 358 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 8 9 18 0.0684% 12.4% YEELQQTAGR K H 99.7% 63.4 25.0 22.3 55.5 0 2 0 0 2 1,194.5750 1,539.62 54,602.3 359 368 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit d, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pd PE=1 SV=3 Q9DCX2 Atp5pd uniprot_Mus-musculus_SP.fasta 18,750.1 98.6% 1 1 2 0.00760% 9.32% ANVAKPGLVDDFEKK R Y 99.7% 37.5 26.8 15.9 35.1 0 0 2 0 2 1,630.8801 2,315.37 90,883.9 59 73 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2 Q9R0K7 Atp2b2 uniprot_Mus-musculus_SP.fasta 132,590.8 100.0% 3 4 5 0.0190% 3.67% AGQVVQIPVAEIVVGDIAQIK R Y 99.7% 33.2 25.0 13.2 33.2 0 0 1 0 2 2,147.2437 5,210.78 8,172.20 197 217 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2 Q9R0K7 Atp2b2 uniprot_Mus-musculus_SP.fasta 132,590.8 100.0% 3 4 5 0.0190% 3.67% IRNEKGEIEQER R I 96.4% 19.0 26.6 13.4 14.4 0 0 2 0 2 1,500.7766 993.492 86,699.5 721 732 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus OX=10090 GN=Atp2b2 PE=1 SV=2 Q9R0K7 Atp2b2 uniprot_Mus-musculus_SP.fasta 132,590.8 100.0% 3 4 5 0.0190% 3.67% SSPTDKHTLVK R G 99.6% 37.2 25.0 17.4 29.7 0 1 1 0 2 1,212.6584 892.682 78,984.1 746 756 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Microtubule-associated protein 1A OS=Mus musculus OX=10090 GN=Map1a PE=1 SV=2 Q9QYR6 Map1a uniprot_Mus-musculus_SP.fasta 300,140.5 100.0% 2 2 3 0.0114% 1.04% VPSAPGQESPVPDTK R S 99.7% 40.0 26.4 13.4 40.0 0 2 0 0 2 1,508.7593 1,881.05 17,468.6 1781 1795 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Microtubule-associated protein 1A OS=Mus musculus OX=10090 GN=Map1a PE=1 SV=2 Q9QYR6 Map1a uniprot_Mus-musculus_SP.fasta 300,140.5 100.0% 2 2 3 0.0114% 1.04% VVSNTIEPLTLFHK R M 99.3% 21.3 25.0 14.4 19.8 0 0 1 0 2 1,597.8949 3,555.20 39,734.5 179 192 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rap-1A OS=Mus musculus OX=10090 GN=Rap1a PE=1 SV=1 P62835,Q99JI6 Rap1a,Rap1b uniprot_Mus-musculus_SP.fasta 20,987.3 98.6% 1 1 2 0.00760% 6.52% INVNEIFYDLVR K Q 99.7% 50.2 25.6 20.0 48.5 0 2 0 0 2 1,494.7951 4,984.18 16,701.6 152 163 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1 Q8VEK3 Hnrnpu uniprot_Mus-musculus_SP.fasta 87,918.5 100.0% 2 2 4 0.0152% 2.62% DRLSASSLTMESFAFLWAGGR R A 99.7% 40.2 27.9 0.000 38.9 0 0 2 0 2 2,302.1285 5,094.69 17,437.5 280 300 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1 Q8VEK3 Hnrnpu uniprot_Mus-musculus_SP.fasta 87,918.5 100.0% 2 2 4 0.0152% 2.62% LSASSLTMESFAFLWAGGR R A 99.0% 34.7 27.2 0.000 34.7 0 2 0 0 2 2,031.0004 5,297.73 4,071.00 282 300 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% ALTVPELTQQMFDAK R N 99.7% 94.3 26.9 22.0 31.4 0 3 0 0 2 1,707.8625 3,333.96 77,992.8 283 297 Empty false Q9ERD7,Q922F4,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% AVLVDLEPGTMDSVR R S 99.7% 44.7 26.7 13.4 33.4 0 2 0 0 2 1,617.8155 3,022.79 52,629.3 63 77 Empty false P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% EIVHLQAGQCGNQIGAK R F 99.7% 52.7 27.3 14.9 0.000 0 0 2 0 2 1,822.9231 2,120.32 78,971.5 3 19 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% EVDEQMLSVQSK K N 99.7% 81.3 25.0 16.6 74.2 0 2 0 0 2 1,408.6626 1,751.27 25,528.1 325 336 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% GHYTEGAELVDAVLDVVR K K 99.7% 61.5 27.3 18.0 55.7 0 0 2 0 2 1,942.9870 4,852.47 28,552.3 104 121 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% GHYTEGAELVDAVLDVVRK K E 99.7% 68.4 27.0 17.8 66.1 0 0 2 0 2 2,071.0820 4,608.00 126313 104 122 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% IMNTFSVVPSPK R V 99.7% 83.9 26.2 17.8 70.3 0 2 0 0 2 1,335.6978 2,738.44 276769 163 174 Empty false P99024,Q9ERD7,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% IREEFPDRIMNTFSVVPSPK K V 97.8% 21.3 28.0 13.2 21.3 0 0 1 0 2 2,378.2175 3,219.95 25,589.9 155 174 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% ISEQFTAMFR R R 99.7% 75.5 25.0 16.4 63.5 0 5 0 0 2 1,245.5933 2,920.93 1302230 381 390 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% LHFFMPGFAPLTSR R G 99.7% 47.1 27.0 15.9 37.7 0 6 2 0 2 1,620.8356 4,009.55 417952 263 276 Empty false P99024,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% LTTPTYGDLNHLVSATMSGVTTCLR K F 99.7% 80.8 28.1 15.4 79.9 0 0 7 0 2 2,724.3334 3,991.65 211238 217 241 Empty false P99024,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% MAATFIGNSTAIQELFK K R 99.7% 87.6 27.2 13.3 0.000 0 3 0 0 2 1,841.9467 4,528.69 48,055.1 363 379 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% MAATFIGNSTAIQELFKR K I 99.7% 69.5 27.4 13.3 12.4 0 0 5 0 2 2,014.0428 4,086.30 452894 363 380 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% MREIVHLQAGQCGNQIGAK - F 99.7% 56.1 27.4 16.1 0.000 0 0 4 0 2 2,126.0596 1,998.24 274344 1 19 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% MSMKEVDEQMLSVQSK R N 99.7% 35.8 25.0 0.000 25.8 0 0 2 0 2 1,917.8604 1,632.77 169014 321 336 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% NSSYFVEWIPNNVK K T 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% RISEQFTAMFR K R 97.2% 29.1 25.7 16.9 23.2 0 1 0 0 2 1,401.6944 2,652.18 41,506.3 380 390 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 72.2 27.8 16.7 4.09 0 0 10 0 2 2,799.3276 4,391.44 245757 78 103 Empty false P99024,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% TAVCDIPPR K G 99.7% 71.4 25.0 21.4 66.1 0 9 0 0 2 1,028.5195 1,861.72 880467 351 359 Empty false P99024,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 100.0% 7 9 17 0.0646% 58.3% YLTVAAVFR R G 99.7% 61.3 25.0 13.1 61.3 0 4 0 0 2 1,039.5934 3,601.98 249483 310 318 Empty false P99024,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3 Q61171 Prdx2 uniprot_Mus-musculus_SP.fasta 21,779.1 100.0% 1 1 2 0.00760% 5.56% QITVNDLPVGR R S 99.7% 44.4 25.0 14.4 38.1 0 2 0 0 2 1,211.6744 2,799.05 92,437.1 140 150 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 98.6% 1 1 2 0.00760% 8.10% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 150 158 Empty false Q3TTY5,P04104,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 98.6% 1 1 2 0.00760% 8.10% FLEQQNKVLETK R W 94.7% 47.3 26.4 17.6 39.0 0 1 0 0 2 1,476.8058 2,422.34 18,699.6 159 170 Empty true Q3UV17 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 98.6% 1 1 2 0.00760% 8.10% NKYEDEINKR K T 99.7% 50.2 25.0 21.4 35.4 0 2 2 0 2 1,308.6543 1,374.03 298665 228 237 Empty false Q922U2,Q6IFZ6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 98.6% 1 1 2 0.00760% 8.10% NLDLDSIIAEVK R A 99.7% 88.2 25.9 28.6 66.3 0 2 0 0 2 1,329.7262 4,367.13 258395 304 315 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 93.7% 0 0 0 0.000% 5.42% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 163 171 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 93.7% 0 0 0 0.000% 5.42% KLLEGEECR R L 99.7% 42.7 25.8 13.4 42.7 0 2 0 0 2 1,133.5621 1,313.69 83,972.0 456 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 93.7% 0 0 0 0.000% 5.42% LLEGEECR K L 99.0% 53.4 25.0 26.3 41.6 0 2 0 0 2 1,005.4671 1,410.53 158728 457 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 93.7% 0 0 0 0.000% 5.42% SLDLDSIIAEVK R A 99.7% 92.8 25.8 24.6 79.4 0 3 0 0 2 1,302.7153 4,357.57 106858 316 327 Empty false Q922U2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ogdh PE=1 SV=3 Q60597 Ogdh uniprot_Mus-musculus_SP.fasta 116,450.6 100.0% 4 4 7 0.0266% 5.18% FGLEGCEVLIPALK R T 99.7% 45.1 26.6 13.7 44.5 0 2 0 0 2 1,545.8348 4,222.90 31,520.0 278 291 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ogdh PE=1 SV=3 Q60597 Ogdh uniprot_Mus-musculus_SP.fasta 116,450.6 100.0% 4 4 7 0.0266% 5.18% IEQLSPFPFDLLLK R E 99.7% 44.3 25.0 15.1 35.0 0 2 0 0 2 1,659.9359 5,285.43 13,006.5 930 943 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ogdh PE=1 SV=3 Q60597 Ogdh uniprot_Mus-musculus_SP.fasta 116,450.6 100.0% 4 4 7 0.0266% 5.18% LSGQDVER R G 99.0% 44.9 25.0 22.0 35.0 0 2 0 0 2 903.4531 1,060.27 108622 673 680 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ogdh PE=1 SV=3 Q60597 Ogdh uniprot_Mus-musculus_SP.fasta 116,450.6 100.0% 4 4 7 0.0266% 5.18% TVDWALAEYMAFGSLLK R E 99.7% 29.8 26.9 13.7 29.8 0 0 1 0 2 1,914.9671 5,547.81 5,324.30 650 666 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 5 6 65 0.247% 16.7% EHALLAYTLGVK R Q 99.7% 40.4 25.0 13.0 40.4 0 2 0 0 2 1,314.7417 3,176.24 109249 135 146 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 5 6 65 0.247% 16.7% IGGIGTVPVGR K V 99.7% 66.0 25.0 14.9 61.3 0 2 0 0 2 1,025.6104 2,398.08 195782 256 266 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 5 6 65 0.247% 16.7% NMITGTSQADCAVLIVAAGVGEFEAGISK K N 99.7% 90.7 28.5 20.5 77.2 0 0 4 0 2 2,909.4386 5,720.58 22,448.8 101 129 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 5 6 65 0.247% 16.7% STTTGHLIYK K C 99.6% 37.4 25.4 0.000 29.1 0 2 0 0 2 1,120.5998 1,507.89 55,797.4 21 30 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 5 6 65 0.247% 16.7% THINIVVIGHVDSGK K S 99.7% 64.8 25.6 13.1 55.4 0 0 55 0 2 1,588.8807 5,829.07 721114 6 20 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 28 OS=Mus musculus OX=10090 GN=Krt28 PE=1 SV=1 A6BLY7 Krt28 uniprot_Mus-musculus_SP.fasta 50,346.9 98.6% 1 2 3 0.0114% 1.95% VTMQNLNNR K L 99.7% 72.7 25.0 24.7 0.000 0 3 0 0 2 1,106.5259 1,009.20 352278 86 94 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyridoxal kinase OS=Mus musculus OX=10090 GN=Pdxk PE=1 SV=1 Q8K183 Pdxk uniprot_Mus-musculus_SP.fasta 35,014.2 98.6% 1 1 2 0.00760% 3.85% MRKPDGSTVTQR R I 99.7% 53.6 26.9 15.8 46.4 0 0 2 0 2 1,391.7062 774.816 55,275.4 207 218 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% FCTGLTQIETLFK R S 99.7% 69.4 26.6 13.3 69.4 0 3 0 0 2 1,557.7984 4,520.38 85,151.7 253 265 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% LAVEALSSLDGDLSGR K Y 99.7% 70.8 27.1 0.000 70.8 0 2 0 0 2 1,602.8335 3,451.22 62,575.6 157 172 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% LGFSEVELVQMVVDGVK R L 99.7% 37.0 26.8 20.0 28.1 0 1 2 0 2 1,848.9777 5,295.39 27,921.1 342 358 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% RGTGGVDTAAVGGVFDVSNADR K L 99.7% 48.5 27.8 0.000 48.5 0 0 2 0 2 2,121.0321 2,984.68 72,441.6 320 341 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% TFLVWINEEDHLR K V 99.7% 34.6 26.4 17.8 17.3 0 0 2 0 2 1,671.8490 3,995.17 144093 224 236 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 6 7 14 0.0532% 24.1% VLTPELYAELR K A 99.7% 51.8 25.0 17.4 37.0 0 2 0 0 2 1,303.7257 3,474.90 107208 33 43 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% CAVVDVPFGGAK K A 99.7% 55.0 26.1 13.0 46.8 0 3 0 0 2 1,219.6141 2,861.80 143245 172 183 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% DDGSWEVIEGYR R A 99.7% 63.8 25.0 0.000 62.3 0 2 0 0 2 1,425.6282 3,360.58 79,272.0 125 136 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% IIAEGANGPTTPEADKIFLER K N 99.7% 55.6 27.8 18.4 51.7 0 0 5 0 2 2,242.1717 3,228.16 161766 400 420 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% ISGASEKDIVHSGLAYTMER R S 99.7% 28.7 27.7 0.000 28.7 0 0 2 0 2 2,164.0704 2,982.05 47,828.1 497 516 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% MVEGFFDR K G 98.9% 34.8 25.0 15.7 34.8 0 2 0 0 2 1,016.4507 2,718.55 113128 69 76 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% NYTDNELEK K I 98.1% 29.9 25.0 13.4 20.9 0 1 0 0 2 1,125.5059 1,586.36 61,422.1 192 200 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% TAAYVNAIEK R V 99.7% 41.4 25.0 14.0 32.7 0 2 0 0 2 1,079.5731 2,045.09 127485 536 545 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% TAMKYNLGLDLR R T 99.7% 37.8 25.1 13.2 35.4 0 0 1 0 2 1,410.7412 2,809.70 61,788.1 524 535 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% YNLGLDLR K T 99.0% 43.9 25.0 26.5 31.2 0 2 0 0 2 963.5259 3,161.89 149483 528 535 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 10 11 22 0.0836% 20.6% YSTDVSVDEVK R A 99.7% 52.1 25.0 13.5 45.8 0 2 0 0 2 1,241.5896 2,110.90 68,668.7 152 162 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% AGAGSATLSMAYAGAR K F 99.7% 93.6 25.0 0.000 90.5 0 2 0 0 2 1,470.7006 2,125.00 55,530.9 242 257 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% ANTFVAELK R G 99.7% 57.8 25.0 18.3 46.5 0 2 0 0 2 992.5411 2,627.25 171851 177 185 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% ETECTYFSTPLLLGK K K 99.7% 60.6 26.3 0.000 60.6 0 3 0 0 2 1,758.8621 3,930.72 46,041.6 282 296 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% GCDVVVIPAGVPR K K 99.7% 51.4 25.0 15.2 46.1 0 2 0 0 2 1,338.7200 3,042.37 107375 92 104 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% IFGVTTLDIVR K A 99.7% 46.6 25.0 17.6 39.3 0 2 0 0 2 1,233.7203 3,956.18 85,875.8 166 176 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% IQEAGTEVVK R A 99.1% 35.4 26.9 31.9 4.78 0 1 0 0 2 1,073.5838 1,453.78 58,152.3 230 239 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% LTLYDIAHTPGVAADLSHIETR R A 99.7% 107 27.2 13.2 101 0 0 3 0 2 2,393.2462 4,003.78 108323 53 74 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 8 8 18 0.0684% 32.0% TIIPLISQCTPK K V 99.3% 39.1 25.0 14.7 33.6 0 3 0 0 2 1,370.7715 3,333.79 274992 204 215 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1 P62259 Ywhae uniprot_Mus-musculus_SP.fasta 29,175.0 100.0% 3 3 7 0.0266% 22.4% AASDIAMTELPPTHPIR K L 99.7% 44.7 27.3 13.0 42.7 0 0 3 0 2 1,835.9323 2,450.65 96,634.7 154 170 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1 P62259 Ywhae uniprot_Mus-musculus_SP.fasta 29,175.0 100.0% 3 3 7 0.0266% 22.4% IISSIEQKEENKGGEDKLK R M 98.4% 22.1 26.9 13.5 21.7 0 0 1 0 2 2,145.1401 1,642.55 19,323.2 62 80 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1 P62259 Ywhae uniprot_Mus-musculus_SP.fasta 29,175.0 100.0% 3 3 7 0.0266% 22.4% NLLSVAYK R N 97.7% 29.8 25.0 13.2 29.8 0 1 0 0 2 907.5247 2,777.22 68,456.2 43 50 Empty false P63101,P68254,P61982 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein epsilon OS=Mus musculus OX=10090 GN=Ywhae PE=1 SV=1 P62259 Ywhae uniprot_Mus-musculus_SP.fasta 29,175.0 100.0% 3 3 7 0.0266% 22.4% VAGMDVELTVEER K N 99.7% 91.7 25.9 0.000 82.4 0 3 0 0 2 1,463.7048 2,523.89 63,338.3 30 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isoleucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Iars2 PE=1 SV=1 Q8BIJ6 Iars2 uniprot_Mus-musculus_SP.fasta 112,805.9 98.0% 1 2 3 0.0114% 1.48% SCQTALAEILDVLVR R A 99.6% 50.7 26.6 19.6 43.6 0 2 1 0 2 1,687.9049 5,646.83 10,621.2 818 832 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% ALTVPELTQQMFDAK R N 99.7% 94.3 26.9 22.0 31.4 0 3 0 0 2 1,707.8625 3,333.96 77,992.8 283 297 Empty true Q9ERD7,Q922F4,Q9D6F9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% AVLVDLEPGTMDSVR R S 99.7% 44.7 26.7 13.4 33.4 0 2 0 0 2 1,617.8155 3,022.79 52,629.3 63 77 Empty true Q9D6F9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% EIVHLQAGQCGNQIGAK R F 99.7% 52.7 27.3 14.9 0.000 0 0 2 0 2 1,822.9231 2,120.32 78,971.5 3 19 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% EVDEQMLNVQNK K N 99.7% 69.0 25.0 18.3 63.5 0 2 0 0 2 1,462.6844 1,719.98 31,735.0 325 336 Empty false P99024,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% GHYTEGAELVDSVLDVVR K K 99.7% 111 27.2 31.3 89.4 0 3 2 0 2 1,958.9819 4,497.05 765490 104 121 Empty false P99024,Q9ERD7,Q922F4,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% GHYTEGAELVDSVLDVVRK K E 99.7% 73.9 27.8 19.5 71.6 0 0 4 0 2 2,087.0769 4,245.10 160394 104 122 Empty false P99024,Q9ERD7,Q922F4,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% IMNTFSVVPSPK R V 99.7% 83.9 26.2 17.8 70.3 0 2 0 0 2 1,335.6978 2,738.44 276769 163 174 Empty true P99024,Q9ERD7,Q9D6F9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% IREEYPDR K I 99.0% 40.2 25.4 21.1 32.4 0 2 0 0 2 1,077.5324 1,205.08 199100 155 162 Empty false P99024,Q922F4,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% IREEYPDRIMNTFSVVPSPK K V 99.6% 25.9 27.9 17.2 23.8 0 0 1 0 2 2,394.2124 2,946.51 31,899.1 155 174 Empty true P99024 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% ISEQFTAMFR R R 99.7% 75.5 25.0 16.4 63.5 0 5 0 0 2 1,245.5933 2,920.93 1302230 381 390 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% LHFFMPGFAPLTSR R G 99.7% 47.1 27.0 15.9 37.7 0 6 2 0 2 1,620.8356 4,009.55 417952 263 276 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% LTTPTYGDLNHLVSATMSGVTTCLR K F 99.7% 80.8 28.1 15.4 79.9 0 0 7 0 2 2,724.3334 3,991.65 211238 217 241 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% MREIVHLQAGQCGNQIGAK - F 99.7% 56.1 27.4 16.1 0.000 0 0 4 0 2 2,126.0596 1,998.24 274344 1 19 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% MSATFIGNSTAIQELFK K R 99.7% 125 27.2 15.8 0.000 0 4 0 0 2 1,873.9366 4,434.16 79,070.1 363 379 Empty false Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% MSATFIGNSTAIQELFKR K I 99.7% 44.1 27.5 13.1 6.63 0 0 3 0 2 2,031.0217 4,213.44 144624 363 380 Empty false Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% MSMKEVDEQMLNVQNK R N 99.7% 43.3 25.0 13.1 43.3 0 0 2 0 2 1,971.8822 1,605.46 117982 321 336 Empty false P99024,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% NSSYFVEWIPNNVK K T 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% RISEQFTAMFR K R 97.2% 29.1 25.7 16.9 23.2 0 1 0 0 2 1,401.6944 2,652.18 41,506.3 380 390 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 72.2 27.8 16.7 4.09 0 0 10 0 2 2,799.3276 4,391.44 245757 78 103 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% TAVCDIPPR K G 99.7% 71.4 25.0 21.4 66.1 0 9 0 0 2 1,028.5195 1,861.72 880467 351 359 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 5 6 12 0.0456% 58.2% YLTVAAVFR R G 99.7% 61.3 25.0 13.1 61.3 0 4 0 0 2 1,039.5934 3,601.98 249483 310 318 Empty true P99024,Q9D6F9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% ADLINNLGTIAK K S 99.7% 53.8 25.1 18.7 33.9 0 1 0 0 2 1,242.7054 3,251.98 58,350.3 101 112 Empty true P11499 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% DLVILLYETALLSSGFSLEDPQTHANR K I 99.7% 58.9 28.1 15.8 57.1 0 0 4 0 2 3,002.5472 5,971.47 7,055.50 662 688 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% DQVANSAFVER K L 96.7% 34.2 25.8 13.5 29.5 0 1 0 0 2 1,235.6014 2,038.27 25,838.0 501 511 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% RAPFDLFENR R K 98.8% 38.8 26.2 15.4 24.6 0 1 0 0 2 1,264.6433 3,302.64 48,601.2 347 356 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% VILHLKEDQTEYLEER K R 99.7% 47.3 27.5 0.000 47.3 0 0 2 0 2 2,015.0446 2,760.91 106167 186 201 Empty true P11499 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 100.0% 6 6 11 0.0418% 11.6% YIDQEELNK K T 99.6% 38.8 25.0 19.7 22.9 0 2 0 0 2 1,151.5580 1,766.06 135989 285 293 Empty true P11499 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% AVCMLSNTTAIAEAWAR R L 99.7% 125 26.6 20.0 119 0 6 3 0 2 1,880.8993 4,131.76 188553 374 390 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% AVFVDLEPTVIDEVR R T 99.7% 79.4 26.2 15.2 62.7 0 2 2 0 2 1,701.9059 4,068.00 290965 65 79 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 61.7 26.5 13.4 55.2 0 0 10 0 2 2,766.2862 3,360.10 221390 281 304 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% DVNAAIATIK K T 99.7% 50.9 25.0 18.3 44.1 0 2 0 0 2 1,015.5783 2,506.98 182136 327 336 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% EDAANNYAR K G 99.7% 44.6 25.0 0.000 36.4 0 2 0 0 2 1,023.4489 929.893 63,983.5 97 105 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% EIIDLVLDR K I 99.7% 49.8 25.0 18.2 43.6 0 3 0 0 2 1,085.6203 3,792.70 148009 113 121 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% GHYTIGKEIIDLVLDR R I 99.7% 71.0 25.3 13.2 62.7 0 0 4 0 2 1,842.0123 4,679.61 88,323.5 106 121 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% HGKYMACCLLYR R G 99.7% 62.5 25.0 0.000 60.5 0 0 2 0 2 1,587.7230 2,138.49 210394 309 320 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% IHFPLATYAPVISAEK R A 99.7% 71.4 25.5 0.000 68.6 0 4 4 0 2 1,756.9633 3,757.89 1113730 265 280 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% LDHKFDLMYAK R R 99.7% 40.6 25.7 18.8 35.0 0 0 5 0 2 1,396.6932 2,269.35 535627 391 401 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% LDHKFDLMYAKR R A 99.7% 31.9 25.8 0.000 24.0 0 0 1 0 2 1,552.7943 2,028.86 130543 391 402 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% LIGQIVSSITASLR R F 99.7% 108 25.0 13.0 108 0 6 2 0 2 1,457.8687 4,806.08 197489 230 243 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% NLDIERPTYTNLNR R L 99.7% 49.9 27.7 22.3 45.8 0 2 1 0 2 1,718.8821 2,596.73 182465 216 229 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% QLFHPEQLITGK R E 99.7% 38.6 25.0 13.3 38.6 0 0 2 0 2 1,410.7742 3,130.22 105635 85 96 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% QLFHPEQLITGKEDAANNYAR R G 99.7% 71.0 28.4 0.000 0.960 0 0 6 0 2 2,416.1894 3,076.09 402289 85 105 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% RNLDIERPTYTNLNR R L 99.1% 25.9 27.2 14.5 24.6 0 0 1 0 2 1,874.9832 2,296.87 89,982.6 215 229 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% TIGGGDDSFNTFFSETGAGK K H 99.7% 116 25.0 0.000 116 0 2 0 0 2 2,007.8933 3,755.54 48,496.0 41 60 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% TIQFVDWCPTGFK R V 99.7% 41.7 25.3 0.000 40.7 0 2 0 0 2 1,598.7674 4,015.36 106448 340 352 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% VGINYQPPTVVPGGDLAK K V 99.7% 56.9 25.1 14.4 48.0 0 2 0 0 2 1,824.9857 3,212.76 151829 353 370 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% YMACCLLYR K G 99.7% 49.4 25.0 0.000 49.4 0 4 0 0 2 1,265.5476 2,877.96 200022 312 320 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 10 0.0380% 50.8% YMACCLLYRGDVVPK K D 94.7% 16.1 25.4 13.1 11.9 0 0 1 0 2 1,860.8807 2,941.06 35,230.8 312 326 Empty false P68368,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% AVCMLSNTTAIAEAWAR R L 99.7% 125 26.6 20.0 119 0 6 3 0 2 1,880.8993 4,131.76 188553 374 390 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% AVFVDLEPTVIDEIR R N 99.7% 79.3 26.7 17.7 57.5 0 2 2 0 2 1,715.9216 4,310.11 116521 65 79 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 61.7 26.5 13.4 55.2 0 0 10 0 2 2,766.2862 3,360.10 221390 281 304 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% DVNAAIAAIK K T 99.7% 56.8 25.0 14.6 48.2 0 2 0 0 2 985.5677 2,739.63 107241 327 336 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% EDAANNYAR K G 99.7% 44.6 25.0 0.000 36.4 0 2 0 0 2 1,023.4489 929.893 63,983.5 97 105 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% GHYTIGKEIIDPVLDR R I 99.7% 38.8 25.4 13.0 34.9 0 0 2 0 2 1,825.9810 3,149.13 207225 106 121 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% HGKYMACCLLYR R G 99.7% 62.5 25.0 0.000 60.5 0 0 2 0 2 1,587.7230 2,138.49 210394 309 320 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% IHFPLATYAPVISAEK R A 99.7% 71.4 25.5 0.000 68.6 0 4 4 0 2 1,756.9633 3,757.89 1113730 265 280 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% LDHKFDLMYAK R R 99.7% 40.6 25.7 18.8 35.0 0 0 5 0 2 1,396.6932 2,269.35 535627 391 401 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% LDHKFDLMYAKR R A 99.7% 31.9 25.8 0.000 24.0 0 0 1 0 2 1,552.7943 2,028.86 130543 391 402 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% LISQIVSSITASLR R F 99.7% 90.9 25.0 19.0 89.6 0 5 2 0 2 1,487.8792 4,938.23 101963 230 243 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% NLDIERPTYTNLNR R L 99.7% 49.9 27.7 22.3 45.8 0 2 1 0 2 1,718.8821 2,596.73 182465 216 229 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% QLFHPEQLITGK R E 99.7% 38.6 25.0 13.3 38.6 0 0 2 0 2 1,410.7742 3,130.22 105635 85 96 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% QLFHPEQLITGKEDAANNYAR R G 99.7% 71.0 28.4 0.000 0.960 0 0 6 0 2 2,416.1894 3,076.09 402289 85 105 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% RNLDIERPTYTNLNR R L 99.1% 25.9 27.2 14.5 24.6 0 0 1 0 2 1,874.9832 2,296.87 89,982.6 215 229 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% SIQFVDWCPTGFK R V 99.7% 57.3 25.0 17.1 41.8 0 2 0 0 2 1,584.7517 3,995.18 108579 340 352 Empty false P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% VGINYQPPTVVPGGDLAK K V 99.7% 56.9 25.1 14.4 48.0 0 2 0 0 2 1,824.9857 3,212.76 151829 353 370 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% YMACCLLYR K G 99.7% 49.4 25.0 0.000 49.4 0 4 0 0 2 1,265.5476 2,877.96 200022 312 320 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 100.0% 3 4 8 0.0304% 46.7% YMACCLLYRGDVVPK K D 94.7% 16.1 25.4 13.1 11.9 0 0 1 0 2 1,860.8807 2,941.06 35,230.8 312 326 Empty false P68369,P05213 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% AVAGDASESALLK R C 99.7% 60.3 26.1 15.9 49.7 0 2 0 0 2 1,231.6529 2,264.37 96,915.8 446 458 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% AVFQANQENLPILK R R 99.7% 48.5 25.0 20.0 37.4 0 1 0 0 2 1,584.8745 3,397.66 17,261.2 431 444 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% DGPNALTPPPTTPEWVK R F 99.7% 43.1 27.3 13.0 40.6 0 2 0 0 2 1,819.9228 3,249.61 30,626.3 75 91 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% EQPLDEELKDAFQNAYLELGGLGER K V 99.2% 25.1 28.7 13.8 25.1 0 0 1 0 2 2,834.3847 5,291.40 7,734.00 527 551 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% GIVVYTGDR R T 99.7% 38.3 25.0 0.000 38.3 0 2 0 0 2 979.5208 2,064.63 190870 256 264 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% GVGIISEGNETVEDIAAR K L 99.7% 85.1 26.8 16.2 81.7 0 1 0 0 2 1,829.9241 3,386.01 65,217.0 630 647 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% IVEIPFNSTNK K Y 98.0% 30.7 26.0 0.000 22.2 0 1 0 0 2 1,261.6787 2,862.68 47,185.8 477 487 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% LIFDNLKK R S 98.4% 30.5 25.0 19.5 18.2 0 2 0 0 2 990.5984 2,549.48 128368 767 774 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% LIIVEGCQR K Q 99.7% 58.7 26.7 23.0 47.7 0 2 0 0 2 1,087.5930 2,208.90 259122 699 707 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% LNIPVNQVNPR R D 97.8% 28.9 25.0 14.0 27.5 0 2 0 0 2 1,263.7168 2,536.43 133203 648 658 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% NMVPQQALVIR K N 99.4% 35.2 25.0 14.9 22.1 0 2 0 0 2 1,284.7094 2,485.85 89,912.7 163 173 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% QGAIVAVTGDGVNDSPALK R K 99.7% 84.8 26.4 0.000 84.8 0 2 0 0 2 1,811.9500 2,778.94 31,225.9 708 726 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% QGAIVAVTGDGVNDSPALKK R A 99.7% 64.2 25.4 0.000 60.5 0 0 2 0 2 1,940.0450 2,450.33 130445 708 727 Empty false Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% SPDFTNENPLETR R N 99.7% 75.7 25.0 14.8 75.2 0 2 0 0 2 1,519.7024 2,783.19 47,524.4 228 240 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% VDNSSLTGESEPQTR K S 99.7% 97.7 25.1 16.8 86.1 0 2 0 0 2 1,619.7508 1,618.93 50,023.8 213 227 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 7 7 11 0.0418% 20.2% VIMVTGDHPITAK K A 99.7% 47.8 25.0 13.3 44.9 0 2 2 0 2 1,397.7460 1,917.86 231759 613 625 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Mus musculus OX=10090 GN=Ppp2r2b PE=1 SV=1 Q6ZWR4 Ppp2r2b uniprot_Mus-musculus_SP.fasta 51,711.3 99.1% 1 1 2 0.00760% 3.16% SFFSEIISSISDVK R F 99.7% 58.3 26.8 16.4 47.7 0 2 0 0 2 1,558.7999 5,547.29 8,518.60 275 288 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadvl PE=1 SV=3 P50544 Acadvl uniprot_Mus-musculus_SP.fasta 70,877.0 98.6% 1 1 1 0.00380% 2.59% LADGAIDLYAMVVVLSR R A 99.7% 52.0 25.1 14.3 37.6 0 1 0 0 2 1,805.9831 5,594.05 2,090.00 569 585 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus OX=10090 GN=Acsf2 PE=1 SV=1 Q8VCW8 Acsf2 uniprot_Mus-musculus_SP.fasta 67,952.3 98.6% 1 1 2 0.00760% 2.44% GGVIAGSPAPPELIR R A 99.7% 40.5 25.0 13.9 40.5 0 2 0 0 2 1,433.8113 3,067.69 54,606.4 379 393 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 5 6 16 0.0608% 20.4% ITVVGVGQVGMACAISILGK K S 99.7% 83.3 25.0 0.000 83.3 0 5 2 0 2 1,973.0925 4,920.08 69,384.7 24 43 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 5 6 16 0.0608% 20.4% IVADKDYSVTANSK K I 99.7% 65.3 25.6 13.2 65.3 0 3 0 0 2 1,510.7748 1,604.70 29,162.9 78 91 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 5 6 16 0.0608% 20.4% LKDDEVAQLRK K S 99.7% 26.5 25.9 26.1 8.26 0 0 2 0 2 1,314.7378 1,562.83 100832 309 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 5 6 16 0.0608% 20.4% MVVDSAYEVIK K L 99.7% 43.6 25.0 0.000 41.9 0 2 0 0 2 1,269.6396 2,638.35 88,002.5 234 244 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 5 6 16 0.0608% 20.4% VIGSGCNLDSAR R F 99.7% 72.7 25.3 17.1 61.8 0 2 0 0 2 1,248.6002 1,729.89 62,455.2 159 170 Empty true P06151 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1 Q8BHN3 Ganab uniprot_Mus-musculus_SP.fasta 106,913.3 98.3% 1 1 1 0.00380% 2.44% DLGIFWLNAAETWVDISSNTAGK R T 99.7% 28.1 28.3 13.3 28.1 0 0 1 0 2 2,508.2407 6,131.48 2,508.10 310 332 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1 Q9DB77 Uqcrc2 uniprot_Mus-musculus_SP.fasta 48,236.0 100.0% 3 3 4 0.0152% 8.61% AVAFQNSQTR K I 99.7% 41.0 25.5 18.4 33.2 0 1 0 0 2 1,121.5697 1,427.15 24,260.2 163 172 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1 Q9DB77 Uqcrc2 uniprot_Mus-musculus_SP.fasta 48,236.0 100.0% 3 3 4 0.0152% 8.61% AVAQGNLSSADVQAAK K N 99.7% 62.2 26.4 0.000 59.7 0 1 0 0 2 1,529.7918 1,867.00 13,748.4 360 375 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1 Q9DB77 Uqcrc2 uniprot_Mus-musculus_SP.fasta 48,236.0 100.0% 3 3 4 0.0152% 8.61% NALANPLYCPDYR K M 99.7% 41.8 25.5 0.000 41.8 0 2 0 0 2 1,566.7370 3,021.68 47,301.3 184 196 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% AIGIGAYLVR R L 99.7% 71.8 25.0 16.3 0.000 0 2 0 0 2 1,032.6201 3,452.58 152829 1823 1832 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ARDKFEEDRIYR R H 98.6% 23.5 26.4 14.9 22.7 0 0 1 0 2 1,597.8082 1,652.49 51,433.2 1359 1370 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ATLVEHGIR K R 97.5% 31.0 25.0 18.0 31.0 0 1 0 0 2 995.5633 1,502.04 93,100.3 1316 1324 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% AVVMDLLR K Q 99.0% 46.3 26.8 23.1 32.8 0 4 0 0 2 916.5285 3,059.19 191481 984 991 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% AYIAYELNSVQHR R Q 99.7% 64.9 26.2 15.2 55.0 0 2 3 0 2 1,563.7913 2,714.69 448940 1156 1168 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% AYVWDNNKDLVEWLEK K Q 99.7% 26.8 27.1 13.8 24.4 0 0 2 0 2 2,021.9968 4,251.02 97,511.6 2260 2275 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% DEPIHILNVAIK R T 99.7% 61.2 25.0 16.2 54.0 0 2 0 0 2 1,361.7789 3,457.23 108289 1282 1293 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% DKFEEDRIYR R H 99.7% 27.3 25.0 14.8 19.8 0 0 1 0 2 1,370.6700 1,833.32 86,793.2 1361 1370 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% EASFEYLQNEGER K L 99.7% 74.2 25.0 0.000 68.4 0 2 0 0 2 1,571.6972 2,678.15 76,074.5 1435 1447 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% EGLPLMVFANWR R G 99.7% 57.0 27.3 13.5 52.1 0 3 0 0 2 1,432.7406 4,898.79 72,416.5 2035 2046 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ENDPSVMR K S 96.3% 27.8 25.0 13.0 27.8 0 1 0 0 2 963.4201 834.295 12,855.4 747 754 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% EVFFMNTQSIVQLVQR R Y 99.7% 79.8 27.1 14.9 68.6 0 2 2 0 2 1,955.0056 4,211.06 92,167.0 958 973 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% FGAYIVDGLR K E 99.7% 53.4 25.0 17.9 53.4 0 1 0 0 2 1,110.5943 3,334.76 75,663.6 2062 2071 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% FGGNKVIEK R V 99.7% 52.6 25.0 35.6 36.8 0 2 0 0 2 991.5572 1,363.51 80,523.2 111 119 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% FVVMVTPEDLK R A 99.7% 53.6 25.3 18.4 37.9 0 3 0 0 2 1,277.6811 3,528.66 140382 152 162 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% GGSWVVIDPTINPR R H 99.7% 49.1 25.0 13.0 36.8 0 2 0 0 2 1,510.8014 3,503.16 79,618.3 2089 2102 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% GNIPTLNR R M 97.7% 29.9 25.0 0.000 20.7 0 2 0 0 2 884.4949 1,957.05 288136 1191 1198 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% GQVLPAHTLLNTVDVELIYEGIK R Y 99.7% 65.3 25.0 14.4 65.3 0 0 2 0 2 2,522.3868 4,692.63 83,491.0 657 679 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% GSVLEPEGTVEIK R F 98.1% 30.5 25.9 22.8 15.9 0 1 0 0 2 1,357.7211 2,666.51 43,759.8 2114 2126 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% GVINDILDWK K T 99.7% 67.2 26.2 22.3 57.1 0 2 0 0 2 1,172.6312 4,356.53 52,377.6 2199 2208 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% HLEPALAFQLELNR R M 99.7% 34.4 25.1 17.5 10.7 0 0 2 0 2 1,650.8963 3,706.92 94,279.8 1371 1384 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% HLEVQILADQYGNAISLFGR R D 99.7% 28.9 27.2 0.000 28.9 0 0 1 0 2 2,244.1773 4,553.82 16,197.2 356 375 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IDTGWLDR R L 99.0% 54.7 25.7 29.8 21.1 0 2 0 0 2 975.4896 2,900.80 224031 607 614 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IDTGWLDRLIAEK R V 99.7% 28.1 25.8 19.5 23.8 0 0 2 0 2 1,529.8325 4,249.85 79,816.3 607 619 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IGLAEEIR R H 99.0% 53.1 25.0 32.6 30.7 0 3 0 0 2 900.5150 2,476.98 193721 1723 1730 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IGSFGPQEDLLFLR R A 99.7% 79.3 25.3 13.5 69.7 0 2 0 0 2 1,591.8481 4,374.87 401544 1687 1700 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IIEFVPTK R A 99.0% 33.1 25.0 13.1 29.2 0 2 0 0 2 946.5609 2,768.15 127260 1921 1928 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IIQQAGQVWFPDSAFK K T 99.7% 69.3 27.0 13.1 59.4 0 3 0 0 2 1,834.9488 3,871.73 126371 2009 2024 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ILNVPQDLYEK R G 99.7% 42.0 26.1 18.1 38.6 0 2 0 0 2 1,331.7207 3,092.20 251392 277 287 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IPVQAVWAGWGHASENPK R L 99.7% 39.7 27.7 18.4 1.33 0 0 1 0 2 1,947.9713 3,489.69 35,128.1 199 216 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ITDIIGKEEGLGAENLR K G 99.7% 46.3 26.0 21.4 35.2 0 0 2 0 2 1,827.9814 2,955.79 118830 1781 1797 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% ITSENPDEGFKPSSGTVQELNFR R S 99.7% 63.4 27.2 15.9 62.7 0 0 4 0 2 2,552.2265 3,038.42 183145 509 531 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% IYVAANSGAR R I 99.7% 38.1 25.0 22.0 32.3 0 2 0 0 2 1,022.5265 1,409.67 158725 1713 1722 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% KVNNADDFPNLFR R Q 95.6% 19.8 26.3 18.5 8.03 0 0 1 0 2 1,549.7758 3,260.87 55,264.9 322 334 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LGGIPVGVVAVETR R T 99.7% 46.0 25.0 13.0 41.0 0 2 0 0 2 1,366.8054 3,320.64 212518 1977 1990 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LGTPELSPTER R K 99.7% 41.2 25.0 18.9 33.3 0 2 0 0 2 1,199.6268 2,156.23 285972 2150 2160 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LILSETSIFDVLPNFFYHSNQVVR K M 99.7% 64.3 26.6 0.000 59.5 0 0 2 0 2 2,838.4825 5,499.38 17,853.3 1122 1145 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LLETESFQLNR K I 99.7% 49.0 26.5 14.8 34.9 0 2 0 0 2 1,349.7060 2,973.05 200673 596 606 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LLLEAMDELEVAFNNTNVR R T 99.5% 29.4 27.9 0.000 22.2 0 0 1 0 2 2,191.1064 5,223.45 6,126.90 1448 1466 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LLLEDLVK R K 99.0% 42.9 25.0 26.7 31.0 0 1 0 0 2 942.5872 3,757.30 42,286.3 2221 2228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% LTFLVAQK R D 99.0% 39.5 25.0 21.2 26.0 0 3 0 0 2 919.5612 2,884.85 265293 1326 1333 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% MAALEVYVR R R 99.7% 45.4 25.0 14.8 25.5 0 2 0 0 2 1,067.5554 2,580.21 192746 1146 1154 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% MGGMVSFR R T 99.0% 56.2 25.0 18.2 38.7 0 2 0 0 2 916.4016 1,504.15 193603 1232 1239 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% MHLYLGAAK K V 96.6% 31.6 25.9 19.3 29.9 0 1 0 0 2 1,019.5344 1,721.28 55,342.9 1400 1408 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% MQLDNPSK K V 99.0% 36.7 25.0 29.1 20.2 0 3 0 0 2 948.4457 902.516 106651 817 824 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% NSISNFLHSLER R G 99.7% 85.8 26.6 18.6 78.1 0 2 4 0 2 1,416.7229 4,022.16 321929 645 656 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% QGPLHGMLINTPYVTK K D 99.7% 27.6 26.4 13.0 26.7 0 0 2 0 2 1,784.9367 2,731.46 110872 1564 1579 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% QLTEEDGVR K S 99.0% 35.2 25.0 0.000 25.0 0 2 0 0 2 1,046.5114 1,358.54 93,116.3 2276 2284 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% QVLIASHLPSYELR R H 99.7% 70.8 25.0 13.1 66.5 0 3 1 0 2 1,625.9010 3,193.02 127211 1082 1095 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% QVNCEVDQR K F 99.7% 46.8 25.0 17.9 38.8 0 3 0 0 2 1,147.5161 1,012.20 136348 1338 1346 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% QVQAEVPGSPIFVMR R L 98.9% 33.7 26.6 0.000 28.9 0 1 0 0 2 1,657.8731 3,588.89 25,786.5 335 349 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% RAYIAYELNSVQHR R Q 99.7% 64.4 26.9 14.1 55.8 0 0 2 0 2 1,719.8924 2,502.93 319924 1155 1168 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% RLLLEDLVK R K 99.7% 49.8 25.0 26.3 22.2 0 2 0 0 2 1,098.6883 3,487.81 72,281.0 2220 2228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% SEREVFFMNTQSIVQLVQR K Y 99.7% 40.5 27.5 0.000 40.5 0 0 2 0 2 2,327.1813 4,038.00 37,619.2 955 973 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% SSMSGLHLVK R Q 98.9% 40.8 26.8 19.7 32.4 0 2 0 0 2 1,074.5613 1,630.94 90,732.9 76 85 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% SVHSSVPLLNSKDPIDR K I 99.7% 39.2 26.4 0.000 39.1 0 0 2 0 2 1,863.9924 2,535.34 426859 1904 1920 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TAQIMFQAYGDK R Q 99.7% 58.4 25.0 0.000 57.2 0 2 0 0 2 1,388.6517 2,508.32 69,768.9 1552 1563 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TCVFEKENDPSVMR K S 99.7% 34.8 25.0 16.0 31.2 0 0 2 0 2 1,727.7728 1,856.59 285537 741 754 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TIQVENSHLILTGAGALNK R V 99.7% 34.6 25.0 14.9 23.0 0 0 5 0 2 1,980.0763 3,400.83 350326 1837 1855 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TLRDPSLPLLELQDIMTSVSGR K I 99.7% 72.4 25.7 13.3 69.3 0 0 3 0 2 2,441.3072 5,244.21 38,639.9 887 908 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TTVEYLIK R L 97.5% 30.9 25.0 17.4 30.9 0 1 0 0 2 966.5507 2,632.33 76,985.2 588 595 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TVELSIPADPANLDSEAK R I 99.7% 53.2 26.7 20.3 41.5 0 3 0 0 2 1,869.9442 3,365.97 65,071.1 1991 2008 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% TYQAIKDFNR K E 99.7% 36.0 25.0 0.000 36.0 0 2 2 0 2 1,255.6430 2,016.52 336274 2025 2034 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VDWQENDFSKR R I 99.7% 25.1 25.0 14.5 21.4 0 0 2 0 2 1,423.6601 2,302.62 238276 266 276 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VETQFQNGHYDK R C 99.7% 47.2 25.0 22.1 0.000 0 2 2 0 2 1,466.6548 1,637.72 145083 996 1007 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VEVGTEVTDYR K F 99.7% 68.3 25.0 23.2 63.2 0 2 0 0 2 1,267.6165 2,277.22 129479 1409 1419 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VLIANNGIAAVK K C 99.7% 59.6 25.0 20.6 13.8 0 2 0 0 2 1,183.7046 2,703.11 123044 120 131 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VNNADDFPNLFR K Q 99.7% 60.8 25.5 15.1 60.8 0 2 0 0 2 1,421.6808 3,624.71 91,843.9 323 334 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VQAERPDTMLGVVCGALHVADVSLR K N 99.7% 29.7 27.9 13.1 26.6 0 0 1 0 2 2,693.3864 4,651.01 25,998.5 620 644 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VQQAELHTGSLPQIQSTALR K G 99.7% 75.2 26.4 17.1 70.9 0 0 2 0 2 2,177.1675 2,932.74 364860 825 844 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VQQAELHTGSLPQIQSTALRGEK K L 99.7% 72.4 26.4 13.3 72.4 0 0 4 0 2 2,491.3266 2,746.62 84,044.7 825 847 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% VSALNSVHCEHVEDEGESR R Y 99.7% 64.2 25.0 0.000 64.2 0 0 2 0 2 2,153.9516 1,761.04 57,928.2 1760 1778 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 73 89 165 0.627% 37.0% YLYLTPQDYKR K V 99.1% 28.7 26.9 13.2 28.7 0 1 2 0 2 1,459.7581 2,700.59 439149 1749 1759 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein theta OS=Mus musculus OX=10090 GN=Ywhaq PE=1 SV=1 P68254 Ywhaq uniprot_Mus-musculus_SP.fasta 27,779.4 100.0% 2 2 2 0.00760% 12.2% AVTEQGAELSNEER K N 99.7% 81.2 25.0 13.8 70.5 0 1 0 0 2 1,532.7187 1,697.82 14,057.7 28 41 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein theta OS=Mus musculus OX=10090 GN=Ywhaq PE=1 SV=1 P68254 Ywhaq uniprot_Mus-musculus_SP.fasta 27,779.4 100.0% 2 2 2 0.00760% 12.2% EKVESELR R S 97.9% 31.1 26.4 21.1 12.5 0 1 0 0 2 989.5262 1,118.17 23,999.2 84 91 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein theta OS=Mus musculus OX=10090 GN=Ywhaq PE=1 SV=1 P68254 Ywhaq uniprot_Mus-musculus_SP.fasta 27,779.4 100.0% 2 2 2 0.00760% 12.2% NLLSVAYK R N 97.7% 29.8 25.0 13.2 29.8 0 1 0 0 2 907.5247 2,777.22 68,456.2 42 49 Empty false P63101,P61982,P62259 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Mitochondrial glutamate carrier 2 OS=Mus musculus OX=10090 GN=Slc25a18 PE=1 SV=4 Q9DB41 Slc25a18 uniprot_Mus-musculus_SP.fasta 34,167.1 99.9% 1 1 1 0.00380% 3.12% QLLMQDGTQR R N 99.1% 39.1 26.3 24.2 31.6 0 1 0 0 2 1,205.5946 1,483.60 22,697.1 96 105 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% AAQEEYIKR K A 99.7% 76.2 25.4 18.7 71.6 0 2 0 0 2 1,107.5793 1,209.92 49,477.3 323 331 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% ADDGRPFPQVIK K S 99.7% 36.6 25.0 17.3 33.6 0 0 2 0 2 1,342.7116 2,453.81 209996 88 99 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% ALANSLACQGK R Y 99.7% 51.6 26.6 13.5 46.7 0 2 0 0 2 1,132.5780 1,682.86 100418 332 342 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% FSNEEIAMATVTALRR K T 98.6% 21.3 27.0 15.1 20.4 0 0 1 0 2 1,824.9273 3,419.32 65,602.7 244 259 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% IGEHTPSALAIMENANVLAR K Y 99.7% 51.3 27.5 0.000 51.3 0 0 2 0 2 2,123.0915 3,061.50 66,064.1 154 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% LQSIGTENTEENRR R F 97.9% 20.9 26.7 14.7 18.9 0 0 1 0 2 1,646.8093 1,401.68 33,515.7 44 57 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% RLQSIGTENTEENRR K F 99.7% 44.1 27.3 13.8 25.8 0 0 2 0 2 1,802.9104 1,305.96 185040 43 57 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 8 8 15 0.0570% 29.9% VDKGVVPLAGTNGETTTQGLDGLSER K C 99.7% 56.5 27.9 13.0 33.7 0 0 3 0 2 2,615.3164 3,081.72 39,776.8 109 134 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% DGSYDMQIDNK R S 99.7% 64.4 25.0 0.000 61.4 0 1 0 0 2 1,285.5367 1,998.77 28,450.7 567 577 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% DLLPSHSTIAK K E 98.8% 33.1 25.0 17.7 24.8 0 1 0 0 2 1,181.6526 2,085.61 33,429.1 491 501 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% EFQEQLESAR R R 99.3% 35.5 25.0 25.7 27.6 0 2 0 0 2 1,236.5855 2,111.37 71,498.5 219 228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% ESVCQAALGLILK K E 99.7% 83.3 25.6 18.0 72.5 0 2 0 0 2 1,401.7772 4,460.86 102214 502 514 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% HAPLVEFEEEESDK R - 99.7% 78.6 25.0 0.000 78.6 0 2 1 0 2 1,658.7545 2,572.57 87,811.2 704 717 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% IAAGEKIPLSQEEIPLQGHAFEAR R I 99.7% 47.7 26.3 20.8 43.7 0 0 2 0 2 2,604.3783 3,221.65 41,436.4 358 381 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% IIEEAPAPGINPEVR K R 99.7% 71.4 26.2 15.5 66.2 0 2 0 0 2 1,604.8644 2,627.61 67,835.3 281 295 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% IIEEAPAPGINPEVRR K K 99.7% 24.6 25.4 17.7 19.8 0 0 2 0 2 1,760.9655 2,355.74 243868 281 296 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% IPLSQEEIPLQGHAFEAR K I 99.7% 65.5 27.4 13.2 65.5 0 0 2 0 2 2,035.0609 3,206.25 132802 364 381 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% KVFFSEGAQANR K H 99.7% 34.9 25.1 15.4 25.9 0 1 1 0 2 1,353.6909 1,930.65 126719 692 703 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% LHTQDQFSPFSFSSGR K R 99.7% 97.7 25.4 13.4 97.7 0 3 2 0 2 1,840.8613 3,270.33 1087080 524 539 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% LVVWASDR K Q 98.8% 34.2 27.6 19.1 23.9 0 1 0 0 2 945.5152 2,530.66 76,206.7 433 440 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% QGDEVSVHYDPMIAK R L 99.7% 27.6 25.0 13.9 20.7 0 0 2 0 2 1,704.7900 2,270.50 268372 418 432 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SDIVIAVTYNR K D 99.7% 62.0 25.3 13.8 49.6 0 2 0 0 2 1,250.6739 2,900.46 75,377.8 556 566 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SEREFQEQLESAR R R 99.7% 57.1 26.0 15.8 50.2 0 1 0 0 2 1,608.7612 2,285.54 9,693.50 216 228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SEREFQEQLESARR R E 99.7% 28.7 27.1 17.1 22.2 0 0 2 0 2 1,764.8623 2,109.33 131523 216 229 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SFNDDAMLIEK K F 97.4% 28.4 25.0 15.4 21.3 0 1 0 0 2 1,298.5935 2,590.85 36,425.9 234 244 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SGKSDIVIAVTYNR R D 99.7% 68.4 25.4 20.0 62.5 0 1 0 0 2 1,522.8224 2,594.84 18,034.3 553 566 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% SNVDFLLR R L 99.0% 56.5 25.0 37.1 43.9 0 2 0 0 2 963.5258 3,224.33 182666 461 468 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% VFFSEGAQANR K H 99.7% 62.8 25.0 18.9 53.4 0 5 0 0 2 1,225.5959 2,259.02 260932 693 703 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% VLGDLSSEDGCTYLK R S 99.7% 116 25.4 0.000 116 0 3 0 0 2 1,656.7788 2,932.24 53,470.3 581 595 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% VLIANRGEIACR K V 96.1% 17.2 25.6 30.1 12.4 0 0 1 0 2 1,371.7526 1,981.27 56,745.4 48 59 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% YCLHQYNIVGLR R S 99.7% 49.4 26.7 0.000 49.4 0 2 2 0 2 1,535.7788 3,003.88 681978 449 460 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% YLSPVSAEGAQGGTIAPMTGTIEK K V 99.7% 32.6 28.0 15.4 21.9 0 0 2 0 2 2,394.1861 2,835.03 65,483.2 632 655 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 25 30 57 0.217% 36.8% YVGAGTVEFIMDSR K H 99.7% 75.7 25.4 14.9 75.7 0 6 0 0 2 1,560.7364 3,862.80 220137 311 324 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit O, mitochondrial OS=Mus musculus OX=10090 GN=Atp5po PE=1 SV=1 Q9DB20 Atp5po uniprot_Mus-musculus_SP.fasta 23,364.4 100.0% 3 3 6 0.0228% 20.7% LGNTQGIISAFSTIMSVHR R G 99.7% 40.8 27.1 0.000 40.8 0 0 2 0 2 2,032.0645 4,696.49 38,045.4 118 136 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit O, mitochondrial OS=Mus musculus OX=10090 GN=Atp5po PE=1 SV=1 Q9DB20 Atp5po uniprot_Mus-musculus_SP.fasta 23,364.4 100.0% 3 3 6 0.0228% 20.7% LVRPPVQVYGIEGR K Y 99.5% 23.8 25.0 0.000 23.8 0 0 2 0 2 1,582.9065 2,849.82 109790 27 40 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit O, mitochondrial OS=Mus musculus OX=10090 GN=Atp5po PE=1 SV=1 Q9DB20 Atp5po uniprot_Mus-musculus_SP.fasta 23,364.4 100.0% 3 3 6 0.0228% 20.7% VSLAVLNPYIK K R 99.7% 65.2 25.0 15.0 53.4 0 2 0 0 2 1,216.7300 3,749.61 69,431.0 74 84 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% AAHVFFTDSCPDALFNELVK R S 99.7% 51.2 27.4 18.2 47.2 0 0 2 0 2 2,281.0959 4,456.95 62,175.0 101 120 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% AQMKNPILER K L 99.1% 22.8 26.4 14.9 9.51 0 0 2 0 2 1,215.6516 1,539.93 76,225.4 162 171 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% HIAEVSQEVTR K S 98.6% 31.1 25.0 0.000 29.6 0 1 0 0 2 1,268.6593 1,537.15 11,503.7 295 305 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% ISEQTYQLSR R W 99.7% 52.8 25.0 17.3 44.2 0 3 0 0 2 1,224.6219 1,983.66 164127 468 477 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% LAEQIATLCATLK R E 99.7% 57.6 25.4 13.7 54.4 0 2 0 0 2 1,431.7878 3,394.66 65,816.2 172 184 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% LNKTDEEISS K - 94.6% 25.4 25.2 13.6 19.6 0 1 0 0 2 1,135.5478 1,221.88 21,229.5 585 594 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% SQLLILDR R G 99.0% 41.7 25.0 16.0 29.4 0 2 0 0 2 957.5729 3,017.48 84,654.4 228 235 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% SSASFSTTAVSAR R Y 99.7% 91.8 25.0 15.4 85.2 0 2 0 0 2 1,271.6224 1,925.36 145455 506 518 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-binding protein 1 OS=Mus musculus OX=10090 GN=Stxbp1 PE=1 SV=2 O08599 Stxbp1 uniprot_Mus-musculus_SP.fasta 67,571.8 100.0% 9 9 16 0.0608% 18.7% SVHSLISDFKDPPTAK K Y 98.9% 23.4 26.3 0.000 23.4 0 0 1 0 2 1,741.9121 2,798.36 145393 83 98 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh5a1 PE=1 SV=1 Q8BWF0 Aldh5a1 uniprot_Mus-musculus_SP.fasta 55,968.6 99.9% 1 1 1 0.00380% 1.91% AAYDAFNSWK R G 99.6% 36.6 25.0 0.000 33.1 0 1 0 0 2 1,172.5370 3,051.67 52,224.1 92 101 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus OX=10090 GN=Ppia PE=1 SV=2 P17742 Ppia uniprot_Mus-musculus_SP.fasta 17,971.8 100.0% 3 4 6 0.0228% 24.4% KITISDCGQL K - 99.7% 47.9 26.0 16.8 47.0 0 2 0 0 2 1,134.5826 2,480.09 115885 155 164 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus OX=10090 GN=Ppia PE=1 SV=2 P17742 Ppia uniprot_Mus-musculus_SP.fasta 17,971.8 100.0% 3 4 6 0.0228% 24.4% VNPTVFFDITADDEPLGR M V 99.7% 68.6 27.0 13.8 68.6 0 2 0 0 1 2,005.9868 4,865.85 7,006.70 2 19 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peptidyl-prolyl cis-trans isomerase A OS=Mus musculus OX=10090 GN=Ppia PE=1 SV=2 P17742 Ppia uniprot_Mus-musculus_SP.fasta 17,971.8 100.0% 3 4 6 0.0228% 24.4% VSFELFADKVPK R T 99.7% 34.3 25.0 13.7 30.5 0 0 2 0 2 1,379.7570 3,494.60 105623 20 31 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Putative adenosylhomocysteinase 3 OS=Mus musculus OX=10090 GN=Ahcyl2 PE=1 SV=1 Q68FL4,Q80SW1 Ahcyl1,Ahcyl2 uniprot_Mus-musculus_SP.fasta 66,899.4 100.0% 2 2 4 0.0152% 3.26% GIVEESVTGVHR K L 99.7% 62.9 25.0 18.3 53.9 0 1 0 0 2 1,282.6750 2,081.28 25,658.4 333 344 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Putative adenosylhomocysteinase 3 OS=Mus musculus OX=10090 GN=Ahcyl2 PE=1 SV=1 Q68FL4,Q80SW1 Ahcyl1,Ahcyl2 uniprot_Mus-musculus_SP.fasta 66,899.4 100.0% 2 2 4 0.0152% 3.26% TPELTWER R V 98.8% 34.9 25.3 23.8 34.1 0 3 0 0 2 1,031.5157 2,622.11 228976 494 501 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus OX=10090 GN=Hnrnpd PE=1 SV=2 Q60668 Hnrnpd uniprot_Mus-musculus_SP.fasta 38,354.5 100.0% 2 2 4 0.0152% 6.20% GFGFVLFK R E 99.0% 39.8 25.0 17.5 31.9 0 2 0 0 2 914.5135 4,191.74 27,106.8 139 146 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein D0 OS=Mus musculus OX=10090 GN=Hnrnpd PE=1 SV=2 Q60668 Hnrnpd uniprot_Mus-musculus_SP.fasta 38,354.5 100.0% 2 2 4 0.0152% 6.20% IFVGGLSPDTPEEK K I 99.7% 52.9 26.5 19.3 36.8 0 2 0 0 2 1,488.7583 2,858.23 38,701.7 184 197 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% ALTVPELTQQMFDAK R N 99.7% 94.3 26.9 22.0 31.4 0 3 0 0 2 1,707.8625 3,333.96 77,992.8 283 297 Empty false Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% GHYTEGAELVDSVLDVVR K K 99.7% 111 27.2 31.3 89.4 0 3 2 0 2 1,958.9819 4,497.05 765490 104 121 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% GHYTEGAELVDSVLDVVRK K E 99.7% 73.9 27.8 19.5 71.6 0 0 4 0 2 2,087.0769 4,245.10 160394 104 122 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% IMNTFSVMPSPK R V 99.7% 47.5 25.0 18.7 38.4 0 1 0 0 2 1,383.6648 2,232.44 56,747.3 163 174 Empty false Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% IREEYPDR K I 99.0% 40.2 25.4 21.1 32.4 0 2 0 0 2 1,077.5324 1,205.08 199100 155 162 Empty false P99024,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% LHFFMPGFAPLTAR R G 99.7% 50.0 26.7 13.1 36.0 0 2 3 0 2 1,620.8357 3,812.56 155642 263 276 Empty false Q9ERD7 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% MASTFIGNSTAIQELFK K R 99.7% 125 27.2 15.8 0.000 0 4 0 0 2 1,857.9416 4,526.66 79,025.2 363 379 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% NSSYFVEWIPNNVK K V 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty false P99024,Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-6 chain OS=Mus musculus OX=10090 GN=Tubb6 PE=1 SV=1 Q922F4 Tubb6 uniprot_Mus-musculus_SP.fasta 50,090.4 98.6% 1 2 4 0.0152% 30.9% YLTVATVFR R G 99.7% 39.3 25.0 14.3 31.0 0 2 0 0 2 1,069.6040 3,453.85 147346 310 318 Empty false Q9ERD7 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1 Q8BH95 Echs1 uniprot_Mus-musculus_SP.fasta 31,475.3 99.5% 1 1 2 0.00760% 3.79% LVEEAIQCAEK K I 98.8% 38.4 26.0 14.4 28.0 0 2 0 0 2 1,289.6407 2,278.94 72,540.4 218 228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Thioredoxin-dependent peroxide reductase, mitochondrial OS=Mus musculus OX=10090 GN=Prdx3 PE=1 SV=1 P20108 Prdx3 uniprot_Mus-musculus_SP.fasta 28,127.0 100.0% 1 1 1 0.00380% 4.67% GLFIIDPNGVVK R H 99.4% 35.7 25.0 13.8 30.0 0 1 0 0 2 1,271.7360 3,865.52 38,035.4 186 197 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Neuronal membrane glycoprotein M6-a OS=Mus musculus OX=10090 GN=Gpm6a PE=1 SV=1 P35802 Gpm6a uniprot_Mus-musculus_SP.fasta 31,150.3 98.6% 1 1 2 0.00760% 5.04% SKEEQELHDIHSTR K S 99.7% 34.9 26.3 13.3 34.9 0 0 2 0 2 1,708.8250 1,355.53 48,523.6 256 269 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 100.0% 5 5 8 0.0304% 11.8% IAPLAEGALPYNLAELQR R Q 99.5% 25.3 25.0 17.2 24.8 0 0 1 0 2 1,939.0649 4,115.39 21,445.8 292 309 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 100.0% 5 5 8 0.0304% 11.8% LTLADIER R I 99.0% 34.7 25.0 20.8 11.4 0 2 0 0 2 930.5256 2,927.73 70,907.0 284 291 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 100.0% 5 5 8 0.0304% 11.8% QQSPGLGRPIWLQIAESAYR R F 99.3% 31.5 25.9 13.1 31.2 0 0 1 0 2 2,270.2042 4,486.40 19,963.4 310 329 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 100.0% 5 5 8 0.0304% 11.8% SSPQFGVTLVTYELLQR R W 99.6% 30.8 26.5 15.9 26.3 0 0 2 0 2 1,938.0332 4,701.18 29,065.9 587 603 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 100.0% 5 5 8 0.0304% 11.8% VSALNVLQDLGLFGLYK R G 99.7% 59.8 25.0 0.000 57.3 0 2 0 0 2 1,850.0424 5,729.22 6,348.50 466 482 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 100.0% 3 4 5 0.0190% 13.8% GIYAYGFEKPSAIQQR R A 99.7% 28.2 26.7 0.000 28.2 0 0 1 0 2 1,827.9389 2,840.52 37,390.6 46 61 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 100.0% 3 4 5 0.0190% 13.8% LDTLCDLYETLTITQAVIFINTR K R 99.7% 28.2 27.1 14.8 0.000 0 0 1 0 2 2,713.4121 6,369.09 2,135.20 260 282 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 100.0% 3 4 5 0.0190% 13.8% TATFAISILQQIELDLK K A 99.7% 52.3 25.0 14.1 50.7 0 2 1 0 2 1,904.0742 5,779.82 15,177.5 83 99 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hibch PE=1 SV=1 Q8QZS1 Hibch uniprot_Mus-musculus_SP.fasta 43,039.4 98.6% 1 1 1 0.00380% 2.86% LGYFLALTGYR K L 99.7% 57.2 25.9 13.1 50.7 0 1 0 0 2 1,273.6940 4,193.39 22,063.7 190 200 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptoporin OS=Mus musculus OX=10090 GN=Synpr PE=1 SV=1 Q8BGN8 Synpr uniprot_Mus-musculus_SP.fasta 29,228.2 98.6% 1 1 3 0.0114% 6.79% LQQVTFEVPTCEGKEQQK R L 99.7% 30.6 27.4 13.4 30.1 0 0 3 0 2 2,149.0597 2,685.15 67,488.7 51 68 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 100.0% 3 3 5 0.0190% 8.40% FGFYEVFK K A 95.5% 26.3 25.1 14.3 20.7 0 1 0 0 2 1,036.5138 3,918.19 38,363.1 133 140 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 100.0% 3 3 5 0.0190% 8.40% GSTASQVLQR K L 99.5% 37.6 25.6 22.4 23.6 0 2 0 0 2 1,046.5589 1,500.50 142970 291 300 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 100.0% 3 3 5 0.0190% 8.40% IQTQPGYANTLR R E 99.7% 44.9 27.0 18.8 26.2 0 2 0 0 2 1,361.7173 2,051.18 197910 185 196 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acadl PE=1 SV=2 P51174 Acadl uniprot_Mus-musculus_SP.fasta 47,908.7 98.6% 1 1 1 0.00380% 2.33% IFSSEHDIFR R E 99.7% 41.2 25.6 19.3 38.1 0 1 0 0 2 1,250.6164 2,717.16 28,755.7 52 61 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 5 6 17 0.0646% 12.8% FGVEQDVDMVFASFIR K K 99.7% 126 26.9 23.9 121 0 3 8 0 2 1,859.8997 5,502.01 73,229.9 231 246 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 5 6 17 0.0646% 12.8% GDYPLEAVR K M 98.7% 31.8 25.6 18.2 24.9 0 1 0 0 2 1,019.5157 2,464.44 46,158.7 368 376 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 5 6 17 0.0646% 12.8% LDIDSAPITAR R N 99.7% 54.8 25.5 20.1 44.3 0 2 0 0 2 1,171.6319 2,626.37 91,871.3 33 43 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 5 6 17 0.0646% 12.8% LNFSHGTHEYHAETIK R N 99.7% 30.6 26.4 0.000 29.4 0 0 2 0 2 1,883.9035 1,889.43 56,821.0 74 89 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 5 6 17 0.0646% 12.8% RFDEILEASDGIMVAR R G 99.7% 29.8 27.4 13.6 29.8 0 0 1 0 2 1,821.9165 3,685.89 26,367.5 279 294 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 100.0% 4 4 6 0.0228% 11.5% GKLDGNQDLIR R F 99.7% 58.8 25.0 19.3 52.1 0 2 0 0 2 1,228.6647 1,875.23 42,407.7 383 393 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 100.0% 4 4 6 0.0228% 11.5% GRPTSTNPIASIFAWTR K G 99.7% 34.0 27.1 13.5 29.6 0 0 2 0 2 1,874.9872 4,418.20 33,570.7 361 377 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 100.0% 4 4 6 0.0228% 11.5% LIDDMVAQVLK R S 96.4% 31.5 25.9 19.8 19.1 0 1 0 0 2 1,244.6921 3,916.37 21,215.9 289 299 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 100.0% 4 4 6 0.0228% 11.5% VCVQTVESGAMTK K D 99.7% 77.6 25.0 13.1 77.6 0 1 0 0 2 1,425.6713 1,763.02 12,597.0 401 413 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcs2 PE=1 SV=2 P54869 Hmgcs2 uniprot_Mus-musculus_SP.fasta 56,824.3 100.0% 1 1 2 0.00760% 1.97% APLVLEQGLR K G 99.7% 47.1 25.0 0.000 47.1 0 2 0 0 2 1,095.6522 2,895.08 105275 222 231 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serum albumin OS=Mus musculus OX=10090 GN=Alb PE=1 SV=3 P07724 Alb uniprot_Mus-musculus_SP.fasta 68,692.9 98.6% 1 1 2 0.00760% 2.14% LGEYGFQNAILVR K Y 99.7% 105 25.3 16.6 88.9 0 2 0 0 2 1,479.7955 3,626.02 240048 422 434 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1 P63001 Rac1 uniprot_Mus-musculus_SP.fasta 21,450.6 99.9% 1 1 4 0.0152% 5.21% YLECSALTQR K G 99.6% 46.0 25.0 13.3 42.2 0 4 0 0 2 1,240.5991 2,244.52 173589 154 163 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% AVCMLSNTTAIAEAWAR R L 99.7% 125 26.6 20.0 119 0 6 3 0 2 1,880.8993 4,131.76 188553 374 390 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% AVFVDLEPTVIDEVR R T 99.7% 79.4 26.2 15.2 62.7 0 2 2 0 2 1,701.9059 4,068.00 290965 65 79 Empty true P68369 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 61.7 26.5 13.4 55.2 0 0 10 0 2 2,766.2862 3,360.10 221390 281 304 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% DVNAAIATIK K T 99.7% 50.9 25.0 18.3 44.1 0 2 0 0 2 1,015.5783 2,506.98 182136 327 336 Empty true P68369 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% EDAANNYAR K G 99.7% 44.6 25.0 0.000 36.4 0 2 0 0 2 1,023.4489 929.893 63,983.5 97 105 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% EIIDLVLDR K I 99.7% 49.8 25.0 18.2 43.6 0 3 0 0 2 1,085.6203 3,792.70 148009 113 121 Empty true P68369 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% GHYTIGKEIIDLVLDR R I 99.7% 71.0 25.3 13.2 62.7 0 0 4 0 2 1,842.0123 4,679.61 88,323.5 106 121 Empty true P68369 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% HGKYMACCLLYR R G 99.7% 62.5 25.0 0.000 60.5 0 0 2 0 2 1,587.7230 2,138.49 210394 309 320 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% IHFPLATYAPVISAEK R A 99.7% 71.4 25.5 0.000 68.6 0 4 4 0 2 1,756.9633 3,757.89 1113730 265 280 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% LDHKFDLMYAK R R 99.7% 40.6 25.7 18.8 35.0 0 0 5 0 2 1,396.6932 2,269.35 535627 391 401 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% LDHKFDLMYAKR R A 99.7% 31.9 25.8 0.000 24.0 0 0 1 0 2 1,552.7943 2,028.86 130543 391 402 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% LISQIVSSITASLR R F 99.7% 90.9 25.0 19.0 89.6 0 5 2 0 2 1,487.8792 4,938.23 101963 230 243 Empty true P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% NLDIERPTYTNLNR R L 99.7% 49.9 27.7 22.3 45.8 0 2 1 0 2 1,718.8821 2,596.73 182465 216 229 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% QLFHPEQLITGK R E 99.7% 38.6 25.0 13.3 38.6 0 0 2 0 2 1,410.7742 3,130.22 105635 85 96 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% QLFHPEQLITGKEDAANNYAR R G 99.7% 71.0 28.4 0.000 0.960 0 0 6 0 2 2,416.1894 3,076.09 402289 85 105 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% RNLDIERPTYTNLNR R L 99.1% 25.9 27.2 14.5 24.6 0 0 1 0 2 1,874.9832 2,296.87 89,982.6 215 229 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% SIQFVDWCPTGFK R V 99.7% 57.3 25.0 17.1 41.8 0 2 0 0 2 1,584.7517 3,995.18 108579 340 352 Empty true P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% TIGGGDDSFNTFFSETGAGK K H 99.7% 116 25.0 0.000 116 0 2 0 0 2 2,007.8933 3,755.54 48,496.0 41 60 Empty true P68369 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% VGINYQPPTVVPGGDLAK K V 99.7% 56.9 25.1 14.4 48.0 0 2 0 0 2 1,824.9857 3,212.76 151829 353 370 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% YMACCLLYR K G 99.7% 49.4 25.0 0.000 49.4 0 4 0 0 2 1,265.5476 2,877.96 200022 312 320 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 21 34 80 0.304% 50.8% YMACCLLYRGDVVPK K D 94.7% 16.1 25.4 13.1 11.9 0 0 1 0 2 1,860.8807 2,941.06 35,230.8 312 326 Empty true P68369,P68368 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2 P14873 Map1b uniprot_Mus-musculus_SP.fasta 270,255.1 100.0% 2 2 2 0.00760% 0.974% AIGNIELGIR R S 99.4% 36.2 25.0 13.4 21.4 0 1 0 0 2 1,055.6209 3,107.26 51,386.3 55 64 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2 P14873 Map1b uniprot_Mus-musculus_SP.fasta 270,255.1 100.0% 2 2 2 0.00760% 0.974% TPEEGGYSYEISEK R T 99.7% 57.4 25.0 0.000 57.4 0 1 0 0 2 1,588.7014 2,263.78 12,253.5 1945 1958 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% ASAELALGENNEVLK K S 99.7% 48.6 26.4 20.2 39.1 0 3 0 0 2 1,557.8119 2,849.23 61,889.5 108 122 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% FVTVQTISGTGALR R V 99.7% 71.1 25.0 18.8 71.1 0 2 0 0 2 1,449.8061 3,066.69 78,985.9 126 139 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% HFIEQGINVCLCQSYAK R N 99.7% 40.5 26.5 0.000 37.9 0 0 2 0 2 2,066.9788 3,101.50 61,798.9 263 279 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% IAATILTSPDLR R K 99.7% 88.7 25.0 18.1 75.0 0 2 0 0 2 1,270.7367 3,143.15 192390 326 337 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% IAATILTSPDLRK R Q 99.7% 64.4 25.0 13.0 62.9 0 2 3 0 2 1,398.8317 2,698.22 439869 326 338 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% ILIRPLYSNPPLNGAR K I 99.7% 28.1 25.0 13.0 11.0 0 0 1 0 2 1,795.0227 3,170.71 65,436.0 310 325 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% NMGLYGER K V 95.6% 33.5 25.0 14.1 23.2 0 1 0 0 2 955.4303 1,410.09 41,014.1 280 287 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% VGAFTVVCK R D 99.7% 61.0 25.0 18.8 51.2 0 2 0 0 2 980.5234 2,332.25 115949 288 296 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% VGAFTVVCKDAEEAKR R V 99.7% 31.4 27.0 0.000 31.4 0 0 1 0 2 1,779.9059 2,416.03 40,884.0 288 303 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 10 11 21 0.0798% 24.9% VGASFLQR R F 99.0% 60.2 25.0 21.6 28.9 0 2 0 0 2 877.4890 2,285.30 130117 140 147 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calretinin OS=Mus musculus OX=10090 GN=Calb2 PE=1 SV=3 Q08331 Calb2 uniprot_Mus-musculus_SP.fasta 31,374.6 98.0% 1 1 2 0.00760% 3.69% LQEYTQTILR K M 99.6% 37.4 25.0 17.1 24.3 0 2 0 0 2 1,264.6897 2,664.23 84,331.9 152 161 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) T-complex protein 1 subunit eta OS=Mus musculus OX=10090 GN=Cct7 PE=1 SV=1 P80313 Cct7 uniprot_Mus-musculus_SP.fasta 59,653.2 98.6% 1 1 2 0.00760% 4.60% INALTAASEAACLIVSVDETIKNPR R S 99.7% 64.5 26.9 20.3 61.8 0 0 2 0 2 2,656.3976 5,531.98 10,006.2 500 524 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 5 6 12 0.0456% 11.7% DLKPENLLLASK R L 99.7% 35.5 25.0 14.6 26.6 0 2 2 0 2 1,340.7786 3,127.75 269077 135 146 Empty true P28652 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 5 6 12 0.0456% 11.7% FTEEYQLFEELGK R G 99.7% 87.3 26.0 13.1 79.1 0 3 0 0 2 1,632.7793 4,049.87 71,599.7 9 21 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 5 6 12 0.0456% 11.7% FYFENLWSR R N 99.7% 54.3 25.0 0.000 48.7 0 2 0 0 2 1,261.5999 4,207.32 61,716.5 397 405 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 5 6 12 0.0456% 11.7% ITQYLDAGGIPR R T 99.7% 86.2 25.9 22.4 67.1 0 2 0 0 2 1,303.7007 2,785.96 110620 434 445 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 5 6 12 0.0456% 11.7% VLAGQEYAAK K I 99.7% 45.1 25.0 18.0 43.2 0 1 0 0 2 1,049.5626 1,560.05 46,001.0 33 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Beta-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napb PE=1 SV=2 P28663 Napb uniprot_Mus-musculus_SP.fasta 33,558.2 100.0% 2 2 3 0.0114% 8.05% LDQWLTTMLLR R I 99.7% 43.5 25.7 14.8 43.0 0 1 0 0 2 1,389.7561 4,635.85 19,915.9 272 282 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Beta-soluble NSF attachment protein OS=Mus musculus OX=10090 GN=Napb PE=1 SV=2 P28663 Napb uniprot_Mus-musculus_SP.fasta 33,558.2 100.0% 2 2 3 0.0114% 8.05% VAAYAAQLEQYQK K A 99.7% 47.6 25.6 17.6 40.5 0 2 0 0 2 1,482.7587 2,678.82 44,133.2 168 180 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hemoglobin subunit beta-1 OS=Mus musculus OX=10090 GN=Hbb-b1 PE=1 SV=2 P02088,P02089,P02104 Hbb-b1,Hbb-b2,Hbb-y uniprot_Mus-musculus_SP.fasta 16,136.7 98.6% 1 1 3 0.0114% 6.80% LLVVYPWTQR R F 99.7% 40.0 25.0 22.3 37.3 0 3 0 0 2 1,274.7256 3,794.36 130473 32 41 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% AILVDLEPGTMDSVR R S 99.7% 56.8 27.0 17.6 53.6 0 3 0 0 2 1,631.8312 3,227.20 70,835.4 63 77 Empty false Q9ERD7,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% ALTVPELTQQVFDAK R N 99.7% 60.6 26.1 13.2 60.4 0 1 0 0 2 1,659.8954 4,074.99 36,282.8 283 297 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% EIVHIQAGQCGNQIGAK R F 99.7% 52.7 27.3 14.9 0.000 0 0 2 0 2 1,822.9231 2,120.32 78,971.5 3 19 Empty false Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% EVDEQMLNVQNK K N 99.7% 69.0 25.0 18.3 63.5 0 2 0 0 2 1,462.6844 1,719.98 31,735.0 325 336 Empty false P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% GHYTEGAELVDSVLDVVR K K 99.7% 111 27.2 31.3 89.4 0 3 2 0 2 1,958.9819 4,497.05 765490 104 121 Empty false Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% GHYTEGAELVDSVLDVVRK K E 99.7% 73.9 27.8 19.5 71.6 0 0 4 0 2 2,087.0769 4,245.10 160394 104 122 Empty false Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% IMNTFSVVPSPK R V 99.7% 83.9 26.2 17.8 70.3 0 2 0 0 2 1,335.6978 2,738.44 276769 163 174 Empty false Q9ERD7,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% IREEYPDR K I 99.0% 40.2 25.4 21.1 32.4 0 2 0 0 2 1,077.5324 1,205.08 199100 155 162 Empty false Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% IREEYPDRIMNTFSVVPSPK K V 99.6% 25.9 27.9 17.2 23.8 0 0 1 0 2 2,394.2124 2,946.51 31,899.1 155 174 Empty false P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% ISEQFTAMFR R R 99.7% 75.5 25.0 16.4 63.5 0 5 0 0 2 1,245.5933 2,920.93 1302230 381 390 Empty false Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% LHFFMPGFAPLTSR R G 99.7% 47.1 27.0 15.9 37.7 0 6 2 0 2 1,620.8356 4,009.55 417952 263 276 Empty false Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% LTTPTYGDLNHLVSATMSGVTTCLR K F 99.7% 80.8 28.1 15.4 79.9 0 0 7 0 2 2,724.3334 3,991.65 211238 217 241 Empty false Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% MAVTFIGNSTAIQELFKR K I 99.7% 43.2 27.0 14.6 43.2 0 0 3 0 2 2,026.0791 4,432.86 264376 363 380 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% MREIVHIQAGQCGNQIGAK - F 99.7% 56.1 27.4 16.1 0.000 0 0 4 0 2 2,126.0596 1,998.24 274344 1 19 Empty false Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% MSMKEVDEQMLNVQNK R N 99.7% 43.3 25.0 13.1 43.3 0 0 2 0 2 1,971.8822 1,605.46 117982 321 336 Empty false P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% NSSYFVEWIPNNVK K T 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty false Q9ERD7,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% RISEQFTAMFR K R 97.2% 29.1 25.7 16.9 23.2 0 1 0 0 2 1,401.6944 2,652.18 41,506.3 380 390 Empty false Q9ERD7,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 72.2 27.8 16.7 4.09 0 0 10 0 2 2,799.3276 4,391.44 245757 78 103 Empty false Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% TAVCDIPPR K G 99.7% 71.4 25.0 21.4 66.1 0 9 0 0 2 1,028.5195 1,861.72 880467 351 359 Empty false Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-5 chain OS=Mus musculus OX=10090 GN=Tubb5 PE=1 SV=1 P99024 Tubb5 uniprot_Mus-musculus_SP.fasta 49,670.6 100.0% 2 3 4 0.0152% 58.3% YLTVAAVFR R G 99.7% 61.3 25.0 13.1 61.3 0 4 0 0 2 1,039.5934 3,601.98 249483 310 318 Empty false Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2 P28652 Camk2b uniprot_Mus-musculus_SP.fasta 60,461.4 100.0% 2 2 3 0.0114% 6.83% DLKPENLLLASK R C 99.7% 35.5 25.0 14.6 26.6 0 2 2 0 2 1,340.7786 3,127.75 269077 136 147 Empty false P11798 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2 P28652 Camk2b uniprot_Mus-musculus_SP.fasta 60,461.4 100.0% 2 2 3 0.0114% 6.83% FTDEYQLYEDIGK R G 99.7% 76.4 25.0 13.0 74.7 0 1 0 0 2 1,620.7430 3,442.87 15,728.6 10 22 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus OX=10090 GN=Camk2b PE=1 SV=2 P28652 Camk2b uniprot_Mus-musculus_SP.fasta 60,461.4 100.0% 2 2 3 0.0114% 6.83% LTQYIDGQGRPR R T 96.8% 21.5 26.5 13.0 19.4 0 0 2 0 2 1,403.7392 1,743.23 118108 498 509 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Mitochondrial import inner membrane translocase subunit TIM14 OS=Mus musculus OX=10090 GN=Dnajc19 PE=1 SV=3 Q9CQV7 Dnajc19 uniprot_Mus-musculus_SP.fasta 12,436.9 98.6% 1 1 1 0.00380% 16.4% ASTVVAVGLTIAAAGFAGR M Y 99.7% 54.0 25.0 0.000 54.0 0 1 0 0 1 1,773.9858 6,462.72 1,808.70 2 20 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 98.6% 1 1 3 0.0114% 7.52% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 178 186 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 98.6% 1 1 3 0.0114% 7.52% FLEQQNQVLQTK R W 99.7% 82.6 26.5 20.2 69.8 0 5 0 0 2 1,475.7854 2,414.25 215818 187 198 Empty false P04104,Q6NXH9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 98.6% 1 1 3 0.0114% 7.52% FLEQQNQVLQTKWELLQQVNTSTR R T 99.7% 58.9 27.6 13.0 11.6 0 0 3 0 2 2,932.5166 3,990.36 125757 187 210 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 98.6% 1 1 3 0.0114% 7.52% NKYEDEINKR K T 99.7% 50.2 25.0 21.4 35.4 0 2 2 0 2 1,308.6543 1,374.03 298665 255 264 Empty false Q8VED5,Q922U2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 4 4 6 0.0228% 9.29% AEAGDNLGALVR R G 99.7% 75.5 25.0 18.6 58.5 0 2 0 0 2 1,185.6223 2,652.84 144576 316 327 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 4 4 6 0.0228% 9.29% GTVVTGTLER R G 96.7% 28.1 25.9 26.1 14.7 0 1 0 0 2 1,032.5685 1,852.70 139083 272 281 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 4 4 6 0.0228% 9.29% TTLTAAITK K I 98.7% 34.0 25.0 13.9 34.0 0 2 0 0 2 919.5460 2,211.90 120996 71 79 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 4 4 6 0.0228% 9.29% YEEIDNAPEER K A 99.7% 51.4 25.0 15.1 44.8 0 1 0 0 2 1,364.5965 1,752.24 27,447.6 92 102 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 3 3 5 0.0190% 7.72% QGVNNAEKFDYVMQFLNK K M 99.5% 24.3 27.1 0.000 24.3 0 0 1 0 2 2,161.0384 3,655.55 28,420.4 352 369 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 3 3 5 0.0190% 7.72% SVINLLFAAYTGDVSALRR K F 99.7% 49.9 25.0 13.0 45.7 0 0 2 0 2 2,066.1393 5,128.14 66,642.6 558 576 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 3 3 5 0.0190% 7.72% YAIAVNDLGTEYVHR K Y 99.7% 34.8 27.4 13.6 24.4 0 0 2 0 2 1,720.8653 3,060.19 123403 298 312 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ACTELGIR R T 99.0% 35.1 26.1 23.2 23.9 0 4 0 0 2 919.4667 1,852.41 358910 55 62 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ADEAYLIGR K G 99.7% 62.8 25.0 20.6 49.4 0 3 0 0 2 1,007.5157 2,392.62 629245 80 88 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ADFAQACQDAGVR R F 99.7% 76.7 25.0 21.6 68.5 0 2 0 0 2 1,408.6275 1,975.95 74,888.4 125 137 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AEAEAQAEELSFPR R S 99.7% 122 25.0 0.000 106 0 5 2 0 2 1,547.7336 2,816.14 1048040 929 942 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AGQRQVFFELNGQLR R S 99.7% 30.4 26.7 20.9 21.0 0 0 2 0 2 1,762.9348 3,260.14 99,070.3 1071 1085 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AGTHILCIK R D 99.0% 34.0 25.0 13.2 25.3 0 1 0 0 2 1,012.5610 1,991.05 69,627.0 733 741 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ALAVSDLNR K A 99.7% 62.5 25.0 18.8 41.3 0 7 0 0 2 958.5316 2,135.30 3796210 1062 1070 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AVRNHQGLLLMDTTFR R D 99.7% 38.2 27.3 13.0 6.79 0 0 2 0 2 1,888.9700 2,789.80 133842 556 571 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AYSEALAAFGNGALFVEK R F 99.7% 97.7 27.1 18.2 86.9 0 13 7 0 2 1,858.9222 4,267.18 466901 220 237 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% AYVEANQMLGDLIK K V 99.7% 118 26.4 31.5 108 0 4 0 0 2 1,580.7991 3,245.69 133585 893 906 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% DAHQSLLATR R V 99.7% 57.5 25.0 23.2 48.8 0 4 0 0 2 1,111.5855 1,717.37 1410250 572 581 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% DFTATFGPLDSLNTR K L 99.7% 81.3 26.1 16.0 69.3 0 8 0 0 2 1,654.8073 3,973.04 554194 1022 1036 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% DMAGLLKPAACTMLVSSLR K D 99.7% 56.9 27.7 14.4 48.8 0 0 4 0 2 2,066.0445 3,758.49 890429 742 760 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% DTQAMKEMHFHPK K A 99.6% 23.8 25.0 0.000 23.8 0 0 4 0 2 1,631.7307 926.287 370435 1091 1103 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% DVKGQIGAPMPGK K V 99.7% 41.7 25.0 13.2 41.7 0 2 3 0 2 1,313.6886 1,506.06 186400 1107 1119 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% EGPEGFAR R A 99.0% 56.7 25.0 20.9 41.7 0 2 0 0 2 862.4054 1,608.03 3900980 548 555 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ELEKDLIDR K H 99.7% 63.6 27.3 30.2 43.1 0 2 0 0 2 1,130.6054 2,054.04 1350920 989 997 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ELIPNIPFQMLLR R G 99.7% 54.7 25.0 23.2 49.5 0 8 2 0 2 1,583.8980 5,026.81 297444 632 644 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% ENGVDAVHPGYGFLSER K A 99.7% 29.5 25.6 16.9 25.5 0 0 5 0 2 1,846.8719 3,079.54 298321 108 124 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% FCEVAKENGMDVFR K V 99.7% 78.8 25.0 13.3 78.8 0 3 10 0 2 1,718.7513 2,415.79 1312160 662 675 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% FIGPSPEVVR R K 99.7% 52.8 26.0 21.8 46.4 0 4 0 0 2 1,100.6099 2,556.00 568542 138 147 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% FIGPSPEVVRK R M 99.5% 37.1 25.0 15.1 31.8 0 2 2 0 2 1,228.7049 2,098.26 316467 138 148 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% FLYECPWR R R 99.0% 37.8 25.0 18.9 26.4 0 1 0 0 2 1,170.5401 3,324.27 90,948.6 618 625 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% GANAVGYTNYPDNVVFK R F 99.7% 106 26.4 13.8 102 0 8 0 0 2 1,828.8864 3,148.53 825346 645 661 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% GLAPVQAYLHIPDIIK R V 99.7% 72.6 25.0 13.4 72.6 0 2 3 0 2 1,748.0108 4,296.73 935059 89 104 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% GLYAAFDCTATMK R S 99.7% 77.9 25.0 13.2 74.8 0 4 0 0 2 1,464.6499 2,988.74 136960 843 855 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% GQIGAPMPGK K V 99.7% 50.6 25.0 0.000 44.9 0 4 0 0 2 971.4982 1,279.36 2090650 1110 1119 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% GTPLDTEVPLER K V 99.7% 52.9 25.2 14.9 45.0 0 2 0 0 2 1,326.6902 2,778.27 1145320 819 830 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% HGEEVTPEDVLSAAMYPDVFAQFK R D 99.7% 60.5 26.1 13.0 60.5 0 0 5 0 2 2,696.2551 4,530.67 113420 998 1021 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% HIEVQILGDQYGNILHLYER R D 99.7% 65.1 27.7 13.1 59.2 0 0 2 0 2 2,410.2516 4,135.41 97,699.9 244 263 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% HYFIEVNSR K L 99.7% 45.8 25.0 24.5 39.1 0 6 0 0 2 1,165.5636 2,312.63 566647 320 328 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IAEEFEVELER K G 99.7% 82.4 25.8 26.5 59.6 0 46 0 0 2 1,363.6740 5,804.76 864750 1044 1054 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IAPYVAHNFNK K L 99.7% 44.6 26.2 20.9 38.0 0 2 1 0 2 1,273.6687 1,982.94 377840 590 600 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IEGRPGASLPPLNLK R E 99.7% 33.2 25.0 13.1 24.3 0 1 3 0 2 1,561.9063 2,904.31 2384210 974 988 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IEGRPGASLPPLNLKELEK R D 99.7% 37.3 25.0 14.4 36.3 0 0 2 0 2 2,061.1706 3,292.16 1074250 974 992 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IEGRPGASLPPLNLKELEKDLIDR R H 99.7% 48.8 25.0 0.000 48.8 0 0 3 0 2 2,673.4939 4,312.02 98,047.7 974 997 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% INGCAIQCR R V 99.7% 64.1 25.0 23.4 51.1 0 3 0 0 2 1,092.4926 1,481.29 459915 369 377 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% IVGDLAQFMVQNGLSR K A 99.7% 121 27.5 17.8 19.6 0 14 3 0 2 1,764.8951 4,043.25 1486230 913 928 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% KAYVEANQMLGDLIK K V 99.7% 99.6 26.3 20.9 90.1 0 3 4 0 2 1,708.8941 2,932.47 514343 892 906 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% KIAPYVAHNFNK K L 99.7% 59.1 26.2 17.7 53.0 0 1 4 0 2 1,401.7637 1,824.13 1004150 589 600 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% KVHVTKDMTLEGDDLILEIE R - 97.7% 25.4 27.6 21.6 12.8 0 0 2 0 2 2,314.1852 3,538.85 122692 1159 1178 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% LDNASAFQGAVISPHYDSLLVK R V 99.7% 99.0 28.2 15.2 2.15 0 0 7 0 2 2,346.1978 3,777.72 922548 407 428 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% LFSMENWGGATFDVAMR K F 99.7% 82.8 25.0 0.000 82.8 0 8 2 0 2 1,931.8779 3,950.20 206882 601 617 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% LQELRELIPNIPFQMLLR R G 99.7% 30.7 25.0 0.000 29.8 0 0 1 0 2 2,239.2635 4,841.29 25,007.3 627 644 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% NHQGLLLMDTTFR R D 99.7% 60.6 27.2 13.1 59.7 0 2 2 0 2 1,545.7844 3,413.24 205409 559 571 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% NHQGLLLMDTTFRDAHQSLLATR R V 95.9% 24.7 27.9 13.5 24.7 0 0 1 0 2 2,654.3471 3,166.15 14,029.4 559 581 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% QENIRINGCAIQCR R V 99.7% 52.8 25.5 0.000 4.24 0 0 1 0 2 1,732.8219 2,245.02 38,647.0 364 377 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% QKADEAYLIGR R G 99.7% 54.5 25.8 18.5 51.3 0 2 0 0 2 1,263.6693 2,051.93 149027 78 88 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% QVFFELNGQLR R S 99.7% 53.3 25.9 18.6 14.6 0 8 0 0 2 1,351.7006 3,668.26 1370410 1075 1085 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% QVGYENAGTVEFLVDK K H 99.7% 87.3 26.1 13.3 27.2 0 5 0 0 2 1,769.8594 3,630.83 140262 301 316 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% QVGYENAGTVEFLVDKHGK K H 99.7% 64.3 27.9 13.9 57.2 0 0 2 0 2 2,091.0507 2,972.81 413642 301 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SFQPDTGRIEVFR R S 99.5% 37.2 26.3 13.2 37.2 0 2 1 0 2 1,551.7915 2,899.46 202233 386 398 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SGEGMGIR R L 99.0% 82.7 25.0 25.6 67.4 0 3 0 0 2 806.3826 1,276.14 184547 399 406 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SILVKDTQAMK R E 99.7% 56.2 25.0 18.9 45.8 0 2 0 0 2 1,249.6823 1,386.52 46,124.4 1086 1096 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SKVLKDLPR R I 99.3% 38.8 25.0 13.1 14.6 0 1 0 0 2 1,055.6573 1,614.42 35,200.6 965 973 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SLPDLGLRQENIR R I 97.9% 20.2 25.0 15.3 8.14 0 0 1 0 2 1,510.8338 2,833.39 720600 356 368 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SRLTSDSVK R L 98.7% 31.2 25.0 30.1 18.4 0 1 0 0 2 992.5371 931.181 39,438.9 289 297 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SSSAPVASPNVR R R 99.7% 55.6 25.0 23.8 45.4 0 2 0 0 2 1,171.6064 1,437.69 787635 19 30 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% SVVEFLQGYIGIPHGGFPEPFR R S 99.7% 84.2 27.5 13.1 77.1 0 0 6 0 2 2,446.2556 4,947.60 340022 943 964 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% TKYSLEYYMGLAEELVR R A 99.7% 89.4 27.5 0.000 85.5 0 3 11 0 2 2,081.0261 5,069.14 330826 716 732 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% TVAVYSEQDTGQMHR R Q 99.7% 43.3 25.0 16.4 37.1 0 0 2 0 2 1,737.7862 1,520.23 877912 63 77 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VAKENGVDAVHPGYGFLSER K A 99.7% 64.9 27.8 16.8 64.5 0 0 6 0 2 2,146.0565 2,805.20 746921 105 124 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VFDYSEYWEGAR R G 99.7% 97.6 25.0 13.1 89.5 0 4 0 0 2 1,521.6644 3,545.05 313453 831 842 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VIAHGKDHPTAATK K M 99.7% 44.2 26.3 17.3 35.5 0 0 2 0 2 1,445.7861 746.861 61,988.2 429 442 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VMVANRGEIAIR K V 96.0% 19.2 25.9 16.6 15.2 0 0 1 0 2 1,344.7417 1,965.47 149958 40 51 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VTTEDPAR R S 98.9% 32.6 25.0 16.0 23.1 0 2 0 0 2 888.4422 838.867 219277 378 385 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VVEIAPATHLDPQLR K S 99.7% 60.7 25.4 18.7 60.4 0 2 4 0 2 1,658.9226 2,880.72 1378320 274 288 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% VVHSYEELEENYTR R A 99.7% 87.3 25.0 13.5 82.3 0 2 6 0 2 1,767.8183 2,547.45 763017 206 219 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 69 121 363 1.38% 62.5% YSLEYYMGLAEELVR K A 99.7% 87.7 26.2 14.3 83.4 0 7 5 0 2 1,851.8834 4,687.25 152604 718 732 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2A type 1-B OS=Mus musculus OX=10090 GN=Hist1h2ab PE=1 SV=1 C0HKE1,C0HKE2,C0HKE3,C0HKE4,C0HKE5,C0HKE6,C0HKE7,C0HKE8,C0HKE9,Q8BFU2,Q8CGP5,Q8CGP6,Q8CGP7,Q8R1M2 H2afj,Hist1h2ab,Hist1h2ac,Hist1h2ad,Hist1h2ae,Hist1h2af,Hist1h2ag,Hist1h2ah,Hist1h2ai,Hist1h2ak,Hist1h2an,Hist1h2ao,Hist1h2ap,Hist3h2a uniprot_Mus-musculus_SP.fasta 14,136.1 98.6% 1 1 2 0.00760% 36.9% VGAGAPVYLAAVLEYLTAEILELAGNAAR R D 99.7% 55.2 25.0 13.1 44.7 0 0 2 0 2 2,915.5878 6,679.17 8,853.40 44 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2A type 1-B OS=Mus musculus OX=10090 GN=Hist1h2ab PE=1 SV=1 C0HKE1,C0HKE2,C0HKE3,C0HKE4,C0HKE5,C0HKE6,C0HKE7,C0HKE8,C0HKE9,Q8BFU2,Q8CGP5,Q8CGP6,Q8CGP7,Q8R1M2 H2afj,Hist1h2ab,Hist1h2ac,Hist1h2ad,Hist1h2ae,Hist1h2af,Hist1h2ag,Hist1h2ah,Hist1h2ai,Hist1h2ak,Hist1h2an,Hist1h2ao,Hist1h2ap,Hist3h2a uniprot_Mus-musculus_SP.fasta 14,136.1 98.6% 1 1 2 0.00760% 36.9% VTIAQGGVLPNIQAVLLPK R K 99.7% 39.4 25.0 0.000 39.4 0 1 2 0 2 1,931.1691 4,467.52 44,208.5 101 119 Empty false Q6GSS7,Q64523 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 99.2% 1 1 2 0.00760% 2.17% EAECVEADSGR R L 99.7% 74.1 25.0 13.0 74.1 0 2 0 0 2 1,222.5005 993.688 29,884.2 182 192 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% AKDINQEVYNFLATAGAK R Y 99.7% 41.7 27.2 13.0 40.9 0 0 2 0 2 1,953.0077 4,078.43 67,052.9 143 160 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% ATIERDGYAQILR R D 99.7% 40.0 26.0 19.0 26.1 0 0 2 0 2 1,505.8072 2,591.42 184428 425 437 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% DINQEVYNFLATAGAK K Y 99.7% 96.6 26.5 13.4 90.5 0 2 2 0 2 1,753.8756 4,742.14 65,662.8 145 160 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% FKLEAPDADELPR K S 99.7% 52.3 26.2 30.2 40.4 0 2 2 0 2 1,500.7695 3,028.27 251565 522 534 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% IVYGHLDDPANQEIER K G 99.7% 63.0 26.4 13.0 59.1 0 0 2 0 2 1,868.9139 2,488.57 325238 69 84 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% LTGSLSGWTSPK K D 99.7% 54.1 26.8 15.7 52.0 0 2 0 0 2 1,233.6475 2,756.65 159159 234 245 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% NAVTQEFGPVPDTAR R Y 99.7% 74.0 26.3 14.8 50.6 0 2 0 0 2 1,601.7919 2,743.51 45,931.0 634 648 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% QGLLPLTFADPSDYNK K I 99.7% 56.2 27.0 0.000 56.2 0 2 0 0 2 1,778.8962 4,109.09 40,603.0 702 717 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% SQFTITPGSEQIR K A 99.7% 47.4 26.9 19.1 41.2 0 2 0 0 2 1,463.7490 2,674.31 93,329.4 412 424 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% VAGILTVK K G 99.0% 44.7 25.0 17.6 13.0 0 2 0 0 2 800.5241 2,331.09 119568 251 258 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% VAMSHFEPSEYIR K Y 99.7% 46.5 25.0 13.0 36.5 0 2 2 0 2 1,581.7366 2,616.82 303034 32 44 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% VAVPSTIHCDHLIEAQVGGEK K D 98.5% 24.4 28.4 13.2 21.4 0 0 1 0 2 2,260.1393 2,687.55 32,226.8 118 138 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% VDVSPTSQR R L 99.7% 38.2 25.0 23.4 31.0 0 2 0 0 2 988.5058 1,194.72 335658 556 564 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 14 17 34 0.129% 23.3% WVVIGDENYGEGSSR R E 99.7% 69.5 25.0 13.5 67.7 0 3 0 0 2 1,667.7660 3,040.29 63,333.6 657 671 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Carbonic anhydrase 2 OS=Mus musculus OX=10090 GN=Ca2 PE=1 SV=4 P00920 Ca2 uniprot_Mus-musculus_SP.fasta 29,033.0 98.6% 1 1 2 0.00760% 6.15% AVQQPDGLAVLGIFLK K I 99.7% 64.1 25.0 0.000 64.1 0 2 0 0 2 1,668.9686 5,113.02 14,818.8 133 148 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-1 OS=Mus musculus OX=10090 GN=Prdx1 PE=1 SV=1 P35700 Prdx1 uniprot_Mus-musculus_SP.fasta 22,177.5 100.0% 2 2 4 0.0152% 10.6% LVQAFQFTDK R H 99.7% 50.9 25.0 13.2 45.2 0 2 0 0 2 1,196.6311 3,016.81 77,809.2 159 168 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-1 OS=Mus musculus OX=10090 GN=Prdx1 PE=1 SV=1 P35700 Prdx1 uniprot_Mus-musculus_SP.fasta 22,177.5 100.0% 2 2 4 0.0152% 10.6% QITINDLPVGR R S 98.0% 36.2 25.0 13.3 0.000 0 2 0 0 2 1,225.6901 3,089.97 95,008.4 141 151 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 98.6% 1 1 2 0.00760% 7.25% ASLENSLEETKGR K Y 99.7% 80.2 26.8 19.3 72.8 0 2 0 0 2 1,433.7231 1,969.64 32,110.5 351 363 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 98.6% 1 1 2 0.00760% 7.25% TRLEQEIATYR K R 99.7% 40.2 26.1 13.0 37.8 0 1 0 0 2 1,379.7278 2,552.86 34,251.7 404 414 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 98.6% 1 1 2 0.00760% 7.25% TRLEQEIATYRR K L 99.6% 24.2 25.8 15.4 22.7 0 0 2 0 2 1,535.8289 2,334.67 204898 404 415 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 98.6% 1 1 2 0.00760% 7.25% VTMQNLNDR K L 99.7% 72.7 25.0 24.7 0.000 0 3 0 0 2 1,106.5260 1,009.20 352278 115 123 Empty false P02535,Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2B type 1-B OS=Mus musculus OX=10090 GN=Hist1h2bb PE=1 SV=3 Q64475 Hist1h2bb uniprot_Mus-musculus_SP.fasta 13,952.7 100.0% 1 1 2 0.00760% 11.9% AMGIMNSFVNDIFER K I 99.7% 64.8 25.0 0.000 64.8 0 2 0 0 2 1,743.8193 4,914.77 30,233.1 59 73 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus OX=10090 GN=Gspt2 PE=1 SV=1 Q149F3,Q8R050 Gspt1,Gspt2 uniprot_Mus-musculus_SP.fasta 69,147.4 98.6% 1 1 1 0.00380% 3.64% SFVPNMIGGASQADLAVLVISAR K K 99.7% 28.9 26.4 17.1 28.9 0 0 1 0 2 2,316.2381 4,939.90 10,272.8 297 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% ADIGVAMGIAGSDVSK K Q 99.7% 78.8 26.7 16.5 75.0 0 2 0 0 2 1,506.7471 2,422.74 39,812.3 718 733 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% CATILLQGK R E 99.7% 61.7 26.3 27.3 49.3 0 3 0 0 2 1,003.5607 2,265.72 328182 508 516 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% CIELSSGSVK K L 99.7% 42.5 25.5 24.4 32.2 0 2 0 0 2 1,079.5402 1,951.99 117563 449 458 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% DGPNALTPPPTTPEWVK R F 99.7% 43.1 27.3 13.0 40.6 0 2 0 0 2 1,819.9228 3,249.61 30,626.3 65 81 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% DVAGDASESALLK R C 99.7% 75.7 26.6 23.0 62.3 0 2 0 0 2 1,275.6428 2,492.32 115559 436 448 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% EQPLDEEMKEAFQNAYLELGGLGER K V 99.6% 27.6 27.7 0.000 18.5 0 0 1 0 2 2,866.3567 5,119.83 6,599.90 517 541 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% GGQDNIPVLK K R 97.6% 28.6 25.0 15.6 15.3 0 1 0 0 2 1,040.5737 2,322.53 61,719.7 425 434 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% GGQDNIPVLKR K D 99.7% 55.5 25.0 13.1 46.5 0 2 0 0 2 1,196.6748 1,979.45 72,260.4 425 435 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% GVGIISEGNETVEDIAAR K L 99.7% 85.1 26.8 16.2 81.7 0 1 0 0 2 1,829.9241 3,386.01 65,217.0 620 637 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% GVVVATGDR R T 99.7% 40.8 25.6 20.1 30.0 0 2 0 0 2 873.4789 1,260.00 140956 246 254 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% LIFDNLKK R S 98.4% 30.5 25.0 19.5 18.2 0 2 0 0 2 990.5984 2,549.48 128368 757 764 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% LIIVEGCQR K Q 99.7% 58.7 26.7 23.0 47.7 0 2 0 0 2 1,087.5930 2,208.90 259122 689 697 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% LNIPVSQVNPR R D 99.7% 50.4 25.0 28.4 44.7 0 2 0 0 2 1,236.7059 2,580.76 108975 638 648 Empty true Q6PIE5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% MQVNAEEVVVGDLVEIK K G 99.7% 43.7 27.2 18.7 39.1 0 0 2 0 2 1,887.9734 4,180.41 47,182.2 168 184 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% MSVEEVCR K K 99.0% 44.8 25.0 16.1 17.0 0 2 0 0 2 1,025.4390 1,216.69 87,008.0 36 43 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% NMVPQQALVIR K E 99.4% 35.2 25.0 14.9 22.1 0 2 0 0 2 1,284.7094 2,485.85 89,912.7 153 163 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% QGAIVAVTGDGVNDSPALK R K 99.7% 84.8 26.4 0.000 84.8 0 2 0 0 2 1,811.9500 2,778.94 31,225.9 698 716 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% QGAIVAVTGDGVNDSPALKK R A 99.7% 64.2 25.4 0.000 60.5 0 0 2 0 2 1,940.0450 2,450.33 130445 698 717 Empty true Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% SSHTWVALSHIAGLCNR K A 99.7% 37.8 27.2 14.8 31.3 0 0 2 0 2 1,908.9497 3,303.14 375632 404 420 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% VDNSSLTGESEPQTR K S 99.7% 97.7 25.1 16.8 86.1 0 2 0 0 2 1,619.7508 1,618.93 50,023.8 203 217 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% VIMVTGDHPITAK K A 99.7% 47.8 25.0 13.3 44.9 0 2 2 0 2 1,397.7460 1,917.86 231759 603 615 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 22 23 43 0.163% 26.7% YNTDCVQGLTHSK K A 99.3% 22.0 25.0 0.000 16.3 0 0 1 0 2 1,522.6956 1,927.39 76,311.0 45 57 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Protein S100-A11 OS=Mus musculus OX=10090 GN=S100a11 PE=1 SV=1 P50543 S100a11 uniprot_Mus-musculus_SP.fasta 11,083.3 98.6% 1 1 2 0.00760% 16.3% TEFLSFMNTELAAFTK K N 99.7% 70.6 27.0 13.1 70.4 0 2 0 0 2 1,849.9041 5,158.86 13,504.4 32 47 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% AAYFGVYDTAK R G 99.1% 36.3 25.5 0.000 31.5 0 1 0 0 2 1,205.5837 2,770.15 54,255.1 189 199 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% DFLAGGIAAAVSK K T 99.7% 79.4 26.0 21.4 43.1 0 2 0 0 2 1,219.6682 3,579.77 126727 11 23 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% EFNGLGDCLTK R I 99.7% 38.7 25.0 14.6 26.5 0 3 0 0 2 1,253.5833 2,744.47 157793 153 163 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% EQGFLSFWR K G 99.7% 43.9 25.0 14.6 31.8 0 2 0 0 2 1,169.5738 4,240.75 158455 64 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% GAWSNVLR K G 98.8% 45.1 27.6 26.3 13.5 0 1 0 0 2 902.4842 2,757.19 41,748.5 273 280 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% GDQALSFLK M D 99.7% 44.1 25.9 18.7 28.1 0 2 0 0 1 1,020.5362 3,814.39 48,883.6 2 10 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% GDQALSFLKDFLAGGIAAAVSK M T 99.7% 69.8 25.9 19.0 62.2 0 2 4 0 1 2,221.1866 6,387.46 30,696.8 2 23 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% GMGGAFVLVLYDEIK R K 99.7% 50.2 26.3 18.2 36.8 0 1 0 0 2 1,627.8403 4,713.95 11,493.4 281 295 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% GMGGAFVLVLYDEIKK R Y 99.7% 44.0 26.0 15.8 39.9 0 0 2 0 2 1,755.9353 4,400.38 150396 281 296 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% IAKDEGANAFFK K G 99.7% 40.4 25.2 14.1 36.8 0 0 1 0 2 1,310.6740 2,343.27 141722 261 272 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% IPKEQGFLSFWR R G 99.3% 24.6 26.0 13.4 24.3 0 0 1 0 2 1,507.8057 3,923.52 38,330.7 61 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% KGADIMYTGTLDCWR R K 95.2% 16.0 25.0 0.000 12.7 0 0 1 0 2 1,802.8203 2,958.13 32,317.1 245 259 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% KGADIMYTGTLDCWRK R I 99.7% 31.6 26.2 13.1 31.6 0 0 2 0 2 1,930.9153 2,640.50 82,781.1 245 260 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% LLLQVQHASK K Q 99.7% 41.2 25.0 14.9 29.0 0 2 0 0 2 1,136.6787 1,998.70 203811 34 43 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% QIFLGGVDR K H 95.9% 26.9 25.4 21.6 11.2 0 1 0 0 2 1,004.5525 2,694.55 60,264.4 97 105 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% TAVAPIER K V 99.0% 36.9 25.0 18.5 18.6 0 2 0 0 2 856.4887 1,455.39 417081 24 31 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% VKLLLQVQHASK R Q 99.7% 34.2 25.0 13.5 31.5 0 0 4 0 2 1,363.8421 2,194.28 306272 32 43 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 18 21 36 0.137% 50.0% YFPTQALNFAFK R D 99.7% 62.7 27.1 18.7 55.4 0 2 0 0 2 1,446.7416 4,210.57 112117 81 92 Empty true P51881 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase catalytic subunit A OS=Mus musculus OX=10090 GN=Atp6v1a PE=1 SV=2 P50516 Atp6v1a uniprot_Mus-musculus_SP.fasta 68,327.4 100.0% 4 4 7 0.0266% 7.78% AKEILQEEEDLAEIVQLVGK K A 97.7% 19.2 25.5 13.3 19.2 0 0 2 0 2 2,254.2180 4,932.16 20,568.0 479 498 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase catalytic subunit A OS=Mus musculus OX=10090 GN=Atp6v1a PE=1 SV=2 P50516 Atp6v1a uniprot_Mus-musculus_SP.fasta 68,327.4 100.0% 4 4 7 0.0266% 7.78% EILQEEEDLAEIVQLVGK K A 99.7% 35.9 26.2 18.2 30.5 0 0 2 0 2 2,055.0859 5,196.04 19,191.8 481 498 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase catalytic subunit A OS=Mus musculus OX=10090 GN=Atp6v1a PE=1 SV=2 P50516 Atp6v1a uniprot_Mus-musculus_SP.fasta 68,327.4 100.0% 4 4 7 0.0266% 7.78% FKDPVKDGEAK K I 99.7% 35.5 26.9 23.4 15.9 0 0 1 0 2 1,233.6476 1,243.61 44,711.9 586 596 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase catalytic subunit A OS=Mus musculus OX=10090 GN=Atp6v1a PE=1 SV=2 P50516 Atp6v1a uniprot_Mus-musculus_SP.fasta 68,327.4 100.0% 4 4 7 0.0266% 7.78% IKADYAQLLEDMQNAFR K S 99.7% 28.0 27.5 13.4 21.9 0 0 2 0 2 2,026.0064 4,727.18 37,648.7 597 613 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-6 OS=Mus musculus OX=10090 GN=Prdx6 PE=1 SV=3 O08709 Prdx6 uniprot_Mus-musculus_SP.fasta 24,871.7 98.6% 1 1 2 0.00760% 7.59% FHDFLGDSWGILFSHPR R D 99.7% 42.1 27.1 17.0 35.0 0 0 2 0 2 2,030.9873 4,576.12 166989 25 41 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% AGQENISVSKR K D 98.7% 41.7 26.7 16.8 30.8 0 1 0 0 2 1,188.6331 1,034.09 15,480.6 433 443 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% DGPNALTPPPTTPEWVK R F 99.7% 43.1 27.3 13.0 40.6 0 2 0 0 2 1,819.9228 3,249.61 30,626.3 73 89 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% DTAGDASESALLK R C 99.7% 67.4 26.0 14.1 53.5 0 2 0 0 2 1,277.6221 2,211.03 114021 444 456 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% GVGIISEGNETVEDIAAR K L 99.7% 85.1 26.8 16.2 81.7 0 1 0 0 2 1,829.9241 3,386.01 65,217.0 627 644 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% LIFDNLKK R S 98.4% 30.5 25.0 19.5 18.2 0 2 0 0 2 990.5984 2,549.48 128368 764 771 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% LIIVEGCQR K Q 99.7% 58.7 26.7 23.0 47.7 0 2 0 0 2 1,087.5930 2,208.90 259122 696 704 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% LNIPVSQVNPR R E 99.7% 50.4 25.0 28.4 44.7 0 2 0 0 2 1,236.7059 2,580.76 108975 645 655 Empty false Q6PIC6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% MQINAEEVVVGDLVEVK K G 99.5% 28.0 27.3 13.5 26.3 0 0 1 0 2 1,887.9734 4,084.82 18,263.3 176 192 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% NMVPQQALVIR K E 99.4% 35.2 25.0 14.9 22.1 0 2 0 0 2 1,284.7094 2,485.85 89,912.7 161 171 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% NSQTDKLVNER R L 99.7% 60.5 26.5 17.2 55.8 0 2 0 0 2 1,303.6601 1,375.06 40,412.3 835 845 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% QGAIVAVTGDGVNDSPALK R K 99.7% 84.8 26.4 0.000 84.8 0 2 0 0 2 1,811.9500 2,778.94 31,225.9 705 723 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% QGAIVAVTGDGVNDSPALKK R A 99.7% 64.2 25.4 0.000 60.5 0 0 2 0 2 1,940.0450 2,450.33 130445 705 724 Empty false Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% SPEFTHENPLETR R N 99.7% 56.0 25.2 13.3 51.4 0 1 0 0 2 1,556.7340 2,401.65 17,229.5 226 238 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% VDNSSLTGESEPQTR K S 99.7% 97.7 25.1 16.8 86.1 0 2 0 0 2 1,619.7508 1,618.93 50,023.8 211 225 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% VIMVTGDHPITAK K A 99.7% 47.8 25.0 13.3 44.9 0 2 2 0 2 1,397.7460 1,917.86 231759 610 622 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 100.0% 6 6 8 0.0304% 19.9% VLGFCQLNLPSGKFPR R G 94.9% 21.3 26.5 13.8 18.4 0 0 1 0 2 1,832.9842 3,776.89 43,051.6 549 564 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH-ubiquinone oxidoreductase chain 5 OS=Mus musculus OX=10090 GN=Mtnd5 PE=1 SV=3 P03921 Mtnd5 uniprot_Mus-musculus_SP.fasta 68,481.2 99.3% 1 1 2 0.00760% 2.14% TSLTLLDLIWLEK K T 98.0% 31.3 25.0 13.5 31.3 0 2 0 0 2 1,544.8937 5,314.47 10,946.9 548 560 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Vesicle-fusing ATPase OS=Mus musculus OX=10090 GN=Nsf PE=1 SV=2 P46460 Nsf uniprot_Mus-musculus_SP.fasta 82,616.5 100.0% 3 3 4 0.0152% 5.51% KLFADAEEEQRR R L 97.4% 19.4 26.6 18.3 13.1 0 0 1 0 2 1,491.7551 1,655.75 60,074.2 304 315 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Vesicle-fusing ATPase OS=Mus musculus OX=10090 GN=Nsf PE=1 SV=2 P46460 Nsf uniprot_Mus-musculus_SP.fasta 82,616.5 100.0% 3 3 4 0.0152% 5.51% MGIGGLDKEFSDIFRR K A 99.6% 25.4 26.7 14.0 21.1 0 0 1 0 2 1,856.9327 3,850.07 39,237.3 218 233 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Vesicle-fusing ATPase OS=Mus musculus OX=10090 GN=Nsf PE=1 SV=2 P46460 Nsf uniprot_Mus-musculus_SP.fasta 82,616.5 100.0% 3 3 4 0.0152% 5.51% VLDDGELLVQQTK R N 99.7% 49.3 26.1 13.1 49.3 0 2 0 0 2 1,457.7849 2,847.56 39,675.7 517 529 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 100.0% 5 5 10 0.0380% 22.7% IAVAAQNCYK K V 99.7% 39.5 25.1 14.8 37.1 0 2 0 0 2 1,137.5721 1,649.98 72,807.1 110 119 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 100.0% 5 5 10 0.0380% 22.7% SNVNDGVAQSTR K I 97.5% 28.7 25.0 14.1 27.6 0 2 0 0 2 1,247.5974 1,043.50 26,392.9 245 256 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 100.0% 5 5 10 0.0380% 22.7% TATPQQAQEVHEK K L 99.7% 63.8 25.3 16.0 56.2 0 2 0 0 2 1,466.7235 1,002.04 19,990.2 226 238 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 100.0% 5 5 10 0.0380% 22.7% VSHALAEGLGVIACIGEK K L 99.7% 28.5 26.1 15.3 22.5 0 0 2 0 2 1,823.9686 3,877.73 76,185.0 164 181 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 100.0% 5 5 10 0.0380% 22.7% VVLAYEPVWAIGTGK K T 99.7% 57.7 25.0 0.000 55.1 0 2 0 0 2 1,602.8891 4,040.60 47,687.0 211 225 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Spliceosome RNA helicase Ddx39b OS=Mus musculus OX=10090 GN=Ddx39b PE=1 SV=1 Q9Z1N5 Ddx39b uniprot_Mus-musculus_SP.fasta 49,036.1 99.7% 1 1 1 0.00380% 4.67% CIALAQLLVEQNFPAIAIHR R G 99.2% 27.3 25.0 0.000 27.3 0 0 1 0 2 2,277.2538 4,863.00 10,654.9 300 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Syntaxin-1B OS=Mus musculus OX=10090 GN=Stx1b PE=1 SV=1 P61264 Stx1b uniprot_Mus-musculus_SP.fasta 33,245.1 98.6% 1 1 1 0.00380% 4.86% TKQELEDLTADIKK K T 99.7% 44.8 26.4 17.0 40.3 0 0 1 0 2 1,631.8854 2,556.43 42,934.4 70 83 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 98.6% 1 1 2 0.00760% 6.57% AQYEDIAQK K S 99.7% 50.8 25.0 22.1 38.7 0 2 0 0 2 1,065.5212 1,548.08 289318 343 351 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 98.6% 1 1 2 0.00760% 6.57% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 176 184 Empty false Q3TTY5,P04104,Q8VED5,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 98.6% 1 1 2 0.00760% 6.57% FLEQQNKVLETK R W 94.7% 47.3 26.4 17.6 39.0 0 1 0 0 2 1,476.8058 2,422.34 18,699.6 185 196 Empty true Q8VED5 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 98.6% 1 1 2 0.00760% 6.57% KLLEGEECR R L 99.7% 42.7 25.8 13.4 42.7 0 2 0 0 2 1,133.5621 1,313.69 83,972.0 471 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 98.6% 1 1 2 0.00760% 6.57% LLEGEECR K L 99.0% 53.4 25.0 26.3 41.6 0 2 0 0 2 1,005.4671 1,410.53 158728 472 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% IGAGDYQPTEQDILR R T 99.7% 70.7 27.0 14.8 64.2 0 2 0 0 2 1,675.8289 2,933.88 73,560.2 163 177 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% IIHEDGFSGEDVK K Q 99.7% 48.6 25.0 17.7 43.4 0 2 0 0 2 1,445.6909 2,010.79 25,896.6 55 67 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% LFDVGGQR R S 99.0% 41.2 25.3 26.5 28.6 0 2 0 0 2 891.4684 2,227.69 247065 199 206 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% LLLLGAGESGK K S 99.7% 39.8 25.0 0.000 0.000 0 2 0 0 2 1,057.6254 2,902.12 123685 36 46 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% NLKEDGISAAK K D 96.4% 28.4 26.2 21.0 9.08 0 1 0 0 2 1,145.6162 1,349.78 25,390.1 22 32 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% QYKPVVYSNTIQSLAAIVR K A 99.1% 20.4 25.0 0.000 20.4 0 0 1 0 2 2,150.1968 4,101.68 43,246.9 68 86 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% SREYQLNDSAK R Y 96.4% 26.8 25.0 13.2 21.7 0 1 0 0 2 1,310.6335 1,273.37 12,513.8 144 154 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 8 8 12 0.0456% 28.2% TTGIVETHFTFK K N 97.9% 30.4 25.3 13.2 24.6 0 1 0 0 2 1,380.7159 2,879.43 33,890.5 182 193 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% ASLYPCPETPQER R K 98.7% 31.7 25.0 13.0 30.2 0 2 0 0 2 1,547.7160 2,305.49 28,569.3 249 261 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% KANIPIMDTGENPEVPFPR R D 98.1% 25.0 27.9 14.0 25.0 0 0 2 0 2 2,141.0699 2,988.65 78,065.1 74 92 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% LGFVAGVINR R E 99.7% 54.8 25.0 16.7 45.0 0 3 0 0 2 1,045.6153 3,119.68 288303 175 184 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% MQTNQTPPTYNK R T 97.8% 30.0 25.0 13.3 30.0 0 1 0 0 2 1,438.6633 1,180.92 8,151.00 362 373 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% NFLELTELK R F 99.5% 44.3 25.0 22.4 38.1 0 1 0 0 2 1,106.6093 3,769.54 45,487.9 121 129 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% QAEIENPLEDPVTGDYVHK R S 99.7% 61.4 27.0 0.000 61.4 0 0 2 0 2 2,154.0352 3,113.34 83,131.0 206 224 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase 116 kDa subunit a isoform 1 OS=Mus musculus OX=10090 GN=Atp6v0a1 PE=1 SV=3 Q9Z1G4 Atp6v0a1 uniprot_Mus-musculus_SP.fasta 96,470.8 100.0% 7 7 12 0.0456% 11.3% SVFIIFFQGDQLK K N 99.7% 65.2 25.8 16.4 49.2 0 1 0 0 2 1,541.8364 4,703.61 13,891.9 225 237 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00760% 9.93% EVATNSELVQSGK R S 99.7% 92.2 26.6 13.2 91.1 0 2 0 0 2 1,361.6907 1,620.09 41,182.5 285 297 Empty false Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00760% 9.93% LASYLDKVR R A 99.7% 47.2 25.0 13.1 36.5 0 2 0 0 2 1,064.6099 2,137.99 135522 95 103 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00760% 9.93% TRLEQEIATYR K R 99.7% 40.2 26.1 13.0 37.8 0 1 0 0 2 1,379.7278 2,552.86 34,251.7 375 385 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00760% 9.93% TRLEQEIATYRR K L 99.6% 24.2 25.8 15.4 22.7 0 0 2 0 2 1,535.8289 2,334.67 204898 375 386 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00760% 9.93% VLDELTLAR R A 99.7% 60.6 25.6 17.1 51.5 0 3 0 0 2 1,029.5940 2,892.06 317497 193 201 Empty false Q61781,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3 Q76MZ3 Ppp2r1a uniprot_Mus-musculus_SP.fasta 65,323.7 99.1% 1 1 3 0.0114% 3.40% QLSQSLLPAIVELAEDAKWR R V 99.7% 42.2 25.0 0.000 42.2 0 0 3 0 2 2,267.2396 5,241.51 27,578.5 399 418 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2 P56564 Slc1a3 uniprot_Mus-musculus_SP.fasta 59,624.2 98.6% 1 2 4 0.0152% 2.76% IVQVTAADAFLDLIR K N 99.7% 99.2 25.0 18.2 89.8 0 2 2 0 2 1,644.9321 4,976.52 55,843.0 161 175 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2A type 2-C OS=Mus musculus OX=10090 GN=Hist2h2ac PE=1 SV=3 Q64523,Q6GSS7 Hist2h2aa1,Hist2h2ac uniprot_Mus-musculus_SP.fasta 14,096.0 100.0% 2 3 5 0.0190% 37.2% VGAGAPVYMAAVLEYLTAEILELAGNAAR R D 99.7% 69.7 27.0 15.4 67.1 0 0 2 0 2 2,933.5442 6,642.33 14,310.9 44 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2A type 2-C OS=Mus musculus OX=10090 GN=Hist2h2ac PE=1 SV=3 Q64523,Q6GSS7 Hist2h2aa1,Hist2h2ac uniprot_Mus-musculus_SP.fasta 14,096.0 100.0% 2 3 5 0.0190% 37.2% VTIAQGGVLPNIQAVLLPK K K 99.7% 39.4 25.0 0.000 39.4 0 1 2 0 2 1,931.1691 4,467.52 44,208.5 101 119 Empty true C0HKE3,Q8BFU2,C0HKE4,C0HKE1,C0HKE2,C0HKE7,Q8R1M2,C0HKE8,C0HKE5,C0HKE6,Q8CGP6,Q8CGP5,C0HKE9,Q8CGP7 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glucose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Gpi PE=1 SV=4 P06745 Gpi uniprot_Mus-musculus_SP.fasta 62,768.8 100.0% 3 3 4 0.0152% 8.96% FAAYFQQGDMESNGKYITK R S 99.7% 25.9 25.0 0.000 18.5 0 0 1 0 2 2,215.0014 2,738.49 20,678.7 348 366 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glucose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Gpi PE=1 SV=4 P06745 Gpi uniprot_Mus-musculus_SP.fasta 62,768.8 100.0% 3 3 4 0.0152% 8.96% ILLANFLAQTEALMK K G 99.7% 42.8 25.0 0.000 41.6 0 2 0 0 2 1,675.9453 5,425.17 9,831.40 424 438 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glucose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Gpi PE=1 SV=4 P06745 Gpi uniprot_Mus-musculus_SP.fasta 62,768.8 100.0% 3 3 4 0.0152% 8.96% NLVNKEVMQMLVELAK K S 99.7% 25.9 25.5 0.000 25.5 0 0 1 0 2 1,859.0130 5,009.60 9,653.71 58 73 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rab GDP dissociation inhibitor beta OS=Mus musculus OX=10090 GN=Gdi2 PE=1 SV=1 Q61598 Gdi2 uniprot_Mus-musculus_SP.fasta 50,539.1 100.0% 3 3 7 0.0266% 8.76% FDLGQDVIDFTGHSLALYR K T 99.7% 38.0 27.5 15.9 36.4 0 0 4 0 2 2,167.0821 4,784.28 59,495.9 175 193 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rab GDP dissociation inhibitor beta OS=Mus musculus OX=10090 GN=Gdi2 PE=1 SV=1 Q61598 Gdi2 uniprot_Mus-musculus_SP.fasta 50,539.1 100.0% 3 3 7 0.0266% 8.76% KFDLGQDVIDFTGHSLALYR K T 99.7% 32.8 27.4 13.0 29.0 0 0 1 0 2 2,295.1771 4,542.12 21,685.9 174 193 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rab GDP dissociation inhibitor beta OS=Mus musculus OX=10090 GN=Gdi2 PE=1 SV=1 Q61598 Gdi2 uniprot_Mus-musculus_SP.fasta 50,539.1 100.0% 3 3 7 0.0266% 8.76% SPYLYPLYGLGELPQGFAR K L 99.7% 76.4 27.1 13.4 74.9 0 2 0 0 2 2,141.1068 4,713.51 6,523.50 222 240 Empty true P50396 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 4 0.0152% 15.2% ATDLLLDDSLVSLFGNRR K L 99.7% 30.7 26.3 21.6 19.5 0 0 2 0 2 2,005.0715 4,675.50 84,761.6 156 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 4 0.0152% 15.2% THLPGFVEQAGALK K A 99.7% 39.2 25.0 22.4 29.4 0 0 2 0 2 1,467.7956 2,960.83 81,988.3 99 112 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein kinase DCLK1 OS=Mus musculus OX=10090 GN=Dclk1 PE=1 SV=1 Q9JLM8 Dclk1 uniprot_Mus-musculus_SP.fasta 84,155.2 98.6% 1 1 1 0.00380% 1.46% SFEALLADLTR R T 99.7% 43.8 25.3 13.1 32.6 0 1 0 0 2 1,235.6631 4,779.42 9,271.40 83 93 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1 Q9D0K2 Oxct1 uniprot_Mus-musculus_SP.fasta 55,990.2 100.0% 2 2 3 0.0114% 4.42% DGSVAIASKPR K E 99.7% 45.1 25.9 27.0 32.6 0 2 0 0 2 1,100.6059 1,161.41 59,182.0 177 187 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1 Q9D0K2 Oxct1 uniprot_Mus-musculus_SP.fasta 55,990.2 100.0% 2 2 3 0.0114% 4.42% TKVVVTMEHSAK K G 99.7% 35.7 26.9 18.8 29.0 0 0 1 0 2 1,345.7145 803.301 10,883.7 435 446 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Histone H2A.Z OS=Mus musculus OX=10090 GN=H2afz PE=1 SV=2 P0C0S6,Q3THW5 H2afv,H2afz uniprot_Mus-musculus_SP.fasta 13,509.2 99.9% 1 1 2 0.00760% 22.7% VGATAAVYSAAILEYLTAEVLELAGNASK R D 99.7% 55.2 25.5 13.4 55.2 0 0 2 0 2 2,895.5350 6,579.32 12,920.8 47 75 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% AYNMLDIIHAVIDER K E 99.7% 38.4 27.2 13.1 29.1 0 0 1 0 2 1,772.9001 5,148.31 9,656.90 315 329 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% DTSYLFITGPEVVK K S 99.7% 66.0 26.0 15.2 65.0 0 2 0 0 2 1,568.8208 3,823.52 77,044.1 221 234 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% FANPFPAAVR K G 99.7% 40.9 26.6 14.6 34.9 0 2 0 0 2 1,089.5839 3,121.65 183624 492 501 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% GAVEIIFK K G 99.0% 43.7 25.0 25.7 15.6 0 2 0 0 2 876.5190 3,075.09 79,932.4 469 476 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% GHQDVEAAQAEYVEK K F 99.7% 89.2 25.0 13.0 85.2 0 1 1 0 2 1,673.7766 1,775.61 83,333.3 477 491 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% HAALLGGGQR R R 99.5% 36.6 25.0 0.000 29.3 0 2 0 0 2 979.5433 1,216.60 94,245.3 46 55 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% HLLGDTNYAWPTAEIAVMGAK K G 99.7% 45.1 28.0 18.2 38.7 0 0 2 0 2 2,274.1226 3,669.69 59,773.6 448 468 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% IQEGVESLAGYADIFLR R N 99.7% 98.5 26.7 14.4 97.3 0 1 1 0 2 1,880.9754 4,869.64 46,263.8 168 184 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% ISLLLDPGSFMESDMFVEHR R C 98.4% 22.9 26.8 16.1 11.6 0 0 3 0 2 2,339.1049 4,369.63 86,035.4 72 91 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% LLYAFAEATVPK K I 99.7% 66.5 25.0 15.2 62.6 0 2 0 0 2 1,322.7355 3,549.79 293784 417 428 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% LVPELDTVVPLESSK R A 99.7% 55.1 25.0 13.6 55.1 0 2 0 0 2 1,625.8998 3,644.55 56,209.8 300 314 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% LVYVFSQDFTVFGGSLSGAHAQK R I 99.7% 52.3 28.2 14.2 52.1 0 0 2 0 2 2,458.2402 4,348.15 70,379.7 120 142 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% NIVVGFAR K M 99.0% 34.8 25.0 24.6 34.2 0 2 0 0 2 875.5097 2,652.50 165542 341 348 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% SVTNEDVTQEQLGGAK K T 99.7% 111 26.9 22.8 90.3 0 3 0 0 2 1,675.8135 1,979.96 100971 235 250 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% THTTVSGVAHR K A 99.6% 39.0 25.0 17.8 35.8 0 2 0 0 2 1,165.6072 790.826 24,662.2 251 261 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 16 19 34 0.129% 44.0% TVGIVGNQPNVASGCLDINSSVK R G 99.7% 41.6 28.1 13.0 40.9 0 0 3 0 2 2,329.1818 3,147.50 66,507.2 353 375 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% ATSASSHLNK M G 99.7% 52.7 25.0 21.1 51.1 0 2 0 0 1 1,057.5272 1,180.63 216314 2 11 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% CIEEAIDKLSK K R 99.7% 41.8 26.3 22.7 33.4 0 0 2 0 2 1,305.6721 2,623.93 93,336.8 269 279 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% DIVEAHYR R A 99.0% 38.0 25.3 24.7 19.6 0 2 0 0 2 1,002.5003 1,639.36 391590 174 181 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% LTGFHETSNINDFSAGVANR R G 99.7% 42.8 27.0 13.9 39.2 0 0 2 0 2 2,150.0261 2,908.23 106939 300 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% QMYMSLPQGEK K V 95.7% 26.3 25.0 20.1 19.3 0 1 0 0 2 1,343.5972 1,656.85 24,538.7 15 25 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% RLTGFHETSNINDFSAGVANR R G 99.7% 86.3 27.8 13.1 82.4 0 0 2 0 2 2,306.1272 2,736.30 64,016.7 299 319 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 7 7 13 0.0494% 20.9% RPSANCDPYAVTEAIVR R T 99.7% 43.4 27.0 14.8 39.1 0 0 2 0 2 1,918.9440 2,953.00 77,535.0 341 357 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rab GDP dissociation inhibitor alpha OS=Mus musculus OX=10090 GN=Gdi1 PE=1 SV=3 P50396 Gdi1 uniprot_Mus-musculus_SP.fasta 50,523.1 100.0% 1 1 3 0.0114% 8.72% KFDLGQDVIDFTGHALALYR R T 99.7% 51.8 27.5 13.1 35.2 0 0 3 0 2 2,279.1822 4,969.53 33,396.9 174 193 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rab GDP dissociation inhibitor alpha OS=Mus musculus OX=10090 GN=Gdi1 PE=1 SV=3 P50396 Gdi1 uniprot_Mus-musculus_SP.fasta 50,523.1 100.0% 1 1 3 0.0114% 8.72% SPYLYPLYGLGELPQGFAR K L 99.7% 76.4 27.1 13.4 74.9 0 2 0 0 2 2,141.1068 4,713.51 6,523.50 222 240 Empty false Q61598 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/calcium exchanger 2 OS=Mus musculus OX=10090 GN=Slc8a2 PE=1 SV=1 Q8K596 Slc8a2 uniprot_Mus-musculus_SP.fasta 100,712.5 98.6% 1 1 2 0.00760% 1.09% ITAEQEEAQR K I 99.7% 58.1 25.0 20.2 42.4 0 2 0 0 2 1,174.5699 1,176.73 31,181.7 635 644 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% DIGAIAQVHAENGDIIAEEQQR R I 99.7% 40.8 27.7 13.7 2.32 0 0 3 0 2 2,378.1586 3,096.91 81,459.9 190 211 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% FQLTDSQIYEVLSVIR R D 99.7% 70.0 25.8 14.6 64.5 0 1 2 0 2 1,911.0223 5,191.11 25,230.1 174 189 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% IVLEDGTLHVTEGSGR K Y 99.7% 35.6 26.0 16.7 30.3 0 0 2 0 2 1,682.8710 2,649.04 251019 452 467 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% KPFPDFVYKR R I 99.7% 37.2 25.0 20.6 30.9 0 0 3 0 2 1,296.7100 2,603.88 208649 472 481 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% QIGENLIVPGGVK K T 99.7% 51.6 25.0 19.3 51.3 0 2 0 0 2 1,323.7633 3,036.35 97,056.7 44 56 Empty true P97427 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 2 OS=Mus musculus OX=10090 GN=Dpysl2 PE=1 SV=2 O08553 Dpysl2 uniprot_Mus-musculus_SP.fasta 62,277.9 100.0% 6 7 15 0.0570% 15.2% SAAEVIAQAR K K 99.7% 69.3 25.0 20.6 57.5 0 2 0 0 2 1,015.5530 1,896.46 215985 259 268 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fumarate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Fh PE=1 SV=3 P97807 Fh uniprot_Mus-musculus_SP.fasta 54,357.1 100.0% 1 1 1 0.00380% 2.76% MPIPVIQAFGILKR R A 99.7% 31.0 25.0 13.1 26.5 0 0 1 0 2 1,582.9504 4,496.40 18,824.8 85 98 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% ADLINNLGTIAK K S 99.7% 53.8 25.1 18.7 33.9 0 1 0 0 2 1,242.7054 3,251.98 58,350.3 96 107 Empty false P07901 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% DLVVLLFETALLSSGFSLEDPQTHSNR K I 98.7% 35.3 27.9 13.2 1.38 0 0 1 0 2 2,989.5156 6,457.14 1,716.20 653 679 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% EQVANSAFVER K V 99.6% 38.0 25.9 0.000 37.7 0 3 0 0 2 1,249.6170 1,990.41 90,658.6 492 502 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% HSQFIGYPITLYLEKER K E 99.4% 25.3 26.6 0.000 25.3 0 0 1 0 2 2,094.1020 3,848.41 29,017.4 205 221 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% RAPFDLFENKK R K 99.7% 28.1 25.1 18.2 12.8 0 0 1 0 2 1,364.7322 2,835.45 29,277.3 338 348 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% SIYYITGESK K E 96.0% 27.5 26.2 16.7 23.4 0 1 0 0 2 1,160.5834 2,424.47 38,530.6 482 491 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% VILHLKEDQTEYLEER K R 99.7% 47.3 27.5 0.000 47.3 0 0 2 0 2 2,015.0446 2,760.91 106167 181 196 Empty false P07901 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 100.0% 5 5 7 0.0266% 15.6% YIDQEELNK K T 99.6% 38.8 25.0 19.7 22.9 0 2 0 0 2 1,151.5580 1,766.06 135989 276 284 Empty false P07901 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% FTQAGSEVSALLGR R I 99.7% 84.5 25.7 13.1 77.9 0 2 0 0 2 1,435.7540 3,425.69 83,564.0 311 324 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% IGLFGGAGVGK K T 99.7% 38.6 25.0 25.1 26.4 0 2 0 0 2 975.5624 2,982.07 80,646.8 202 212 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% IMDPNIVGNEHYDVAR R G 99.7% 50.5 25.2 13.1 47.7 0 0 2 0 2 1,858.8754 2,444.06 93,233.7 407 422 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% LVLEVAQHLGESTVR R T 99.7% 81.3 25.0 13.1 81.3 0 3 1 0 2 1,650.9174 3,211.22 115102 95 109 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% SLQDIIAILGMDELSEEDKLTVSR K A 99.7% 55.1 28.0 14.1 50.2 0 0 5 0 2 2,691.3762 5,155.14 36,882.3 433 456 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% TVLIMELINNVAK K A 99.7% 71.8 25.0 15.0 54.4 0 2 0 0 2 1,457.8397 5,001.42 23,619.5 213 225 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% VLDSGAPIKIPVGPETLGR K I 99.7% 57.9 25.0 13.3 57.5 0 0 2 0 2 1,919.0964 3,419.62 211888 125 143 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 8 10 21 0.0798% 23.1% VVDLLAPYAK K G 99.4% 44.5 25.0 23.8 29.0 0 2 0 0 2 1,088.6351 3,312.32 139077 189 198 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 PE=1 SV=2 Q62420 Sh3gl2 uniprot_Mus-musculus_SP.fasta 39,956.2 100.0% 2 2 3 0.0114% 6.82% QAVQILQQVTVR K L 99.7% 79.4 25.0 13.7 79.4 0 2 0 0 2 1,382.8115 3,112.26 69,663.5 228 239 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 PE=1 SV=2 Q62420 Sh3gl2 uniprot_Mus-musculus_SP.fasta 39,956.2 100.0% 2 2 3 0.0114% 6.82% TIEYLQPNPASR K A 99.7% 46.2 26.5 17.1 39.1 0 1 0 0 2 1,388.7169 2,457.46 41,264.1 54 65 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Biotin--protein ligase OS=Mus musculus OX=10090 GN=Hlcs PE=1 SV=1 Q920N2 Hlcs uniprot_Mus-musculus_SP.fasta 78,517.1 98.6% 1 1 3 0.0114% 2.35% IPFVQHLMSLAVVEAVR R S 99.7% 33.3 25.0 13.1 33.3 0 0 3 0 2 1,909.0728 4,950.86 35,139.8 534 550 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Annexin A2 OS=Mus musculus OX=10090 GN=Anxa2 PE=1 SV=2 P07356 Anxa2 uniprot_Mus-musculus_SP.fasta 38,678.1 99.8% 1 1 2 0.00760% 4.72% SALSGHLETVILGLLK K T 99.7% 30.9 25.0 0.000 30.9 0 0 2 0 2 1,650.9791 4,968.88 22,400.5 89 104 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4 P16546 Sptan1 uniprot_Mus-musculus_SP.fasta 284,600.8 100.0% 1 1 2 0.00760% 0.769% IAALQAFADQLIAVDHYAK K G 99.7% 30.4 26.7 0.000 30.4 0 0 2 0 2 2,058.1020 4,853.76 33,024.5 1501 1519 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1 Q99PU8 Dhx30 uniprot_Mus-musculus_SP.fasta 136,671.8 97.6% 1 1 1 0.00380% 1.56% NLLNSVIGRALGISHAKDK K L 99.5% 28.9 25.0 16.8 7.34 0 0 1 0 2 2,006.1507 4,227.81 36,144.4 78 96 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Polyubiquitin-B OS=Mus musculus OX=10090 GN=Ubb PE=2 SV=1 P0CG49,P0CG50,P62983,P62984 Rps27a,Uba52,Ubb,Ubc uniprot_Mus-musculus_SP.fasta 34,370.1 100.0% 2 2 4 0.0152% 8.20% ESTLHLVLR K L 99.7% 45.6 25.0 15.3 45.6 0 2 0 0 2 1,067.6208 2,629.02 103402 64 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Polyubiquitin-B OS=Mus musculus OX=10090 GN=Ubb PE=2 SV=1 P0CG49,P0CG50,P62983,P62984 Rps27a,Uba52,Ubb,Ubc uniprot_Mus-musculus_SP.fasta 34,370.1 100.0% 2 2 4 0.0152% 8.20% TITLEVEPSDTIENVK K A 99.6% 42.0 27.8 16.3 38.1 0 2 0 0 2 1,787.9275 3,239.75 67,817.0 12 27 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Rho GDP-dissociation inhibitor 1 OS=Mus musculus OX=10090 GN=Arhgdia PE=1 SV=3 Q99PT1 Arhgdia uniprot_Mus-musculus_SP.fasta 23,408.0 100.0% 1 1 2 0.00760% 7.84% VAVSADPNVPNVIVTR R L 99.7% 45.8 25.0 0.000 45.8 0 2 0 0 2 1,650.9173 2,963.77 23,496.8 59 74 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-10 OS=Mus musculus OX=10090 GN=Rab10 PE=1 SV=1 P61027 Rab10 uniprot_Mus-musculus_SP.fasta 22,542.1 100.0% 2 2 4 0.0152% 11.0% AFLTLAEDILR K K 99.7% 53.7 25.0 13.1 27.9 0 2 0 0 2 1,261.7152 4,750.61 38,850.5 162 172 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ras-related protein Rab-10 OS=Mus musculus OX=10090 GN=Rab10 PE=1 SV=1 P61027 Rab10 uniprot_Mus-musculus_SP.fasta 22,542.1 100.0% 2 2 4 0.0152% 11.0% LLLIGDSGVGK K T 99.0% 39.7 25.0 13.9 0.000 0 2 0 0 2 1,071.6411 3,103.91 77,369.6 12 22 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) DmX-like protein 2 OS=Mus musculus OX=10090 GN=Dmxl2 PE=1 SV=3 Q8BPN8 Dmxl2 uniprot_Mus-musculus_SP.fasta 338,208.8 99.8% 1 1 2 0.00760% 0.561% HGNIQVSCVECSNQHGR K V 99.7% 34.0 25.0 0.000 34.0 0 0 2 0 2 1,981.8716 1,443.94 26,805.7 55 71 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-synuclein OS=Mus musculus OX=10090 GN=Snca PE=1 SV=2 O55042 Snca uniprot_Mus-musculus_SP.fasta 14,484.3 100.0% 3 3 3 0.0114% 30.0% AKEGVVAAAEK K T 99.7% 42.2 26.4 25.4 27.7 0 1 0 0 2 1,072.5997 977.511 14,684.6 11 21 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-synuclein OS=Mus musculus OX=10090 GN=Snca PE=1 SV=2 O55042 Snca uniprot_Mus-musculus_SP.fasta 14,484.3 100.0% 3 3 3 0.0114% 30.0% TKEGVVHGVTTVAEK K T 94.8% 17.5 25.0 13.0 15.9 0 0 1 0 2 1,554.8487 1,597.40 38,900.9 44 58 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-synuclein OS=Mus musculus OX=10090 GN=Snca PE=1 SV=2 O55042 Snca uniprot_Mus-musculus_SP.fasta 14,484.3 100.0% 3 3 3 0.0114% 30.0% TVEGAGNIAAATGFVK K K 99.7% 65.1 26.5 14.8 65.1 0 1 0 0 2 1,505.7959 3,103.06 20,207.3 81 96 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isochorismatase domain-containing protein 2A OS=Mus musculus OX=10090 GN=Isoc2a PE=1 SV=1 P85094 Isoc2a uniprot_Mus-musculus_SP.fasta 22,417.8 98.6% 1 1 3 0.0114% 8.25% FRPSIAYFPQIVSVAAR K M 99.7% 32.4 25.0 13.8 31.0 0 0 3 0 2 1,922.0646 4,110.26 81,218.8 27 43 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Mitochondrial carrier homolog 2 OS=Mus musculus OX=10090 GN=Mtch2 PE=1 SV=1 Q791V5 Mtch2 uniprot_Mus-musculus_SP.fasta 33,500.0 98.6% 1 1 2 0.00760% 7.92% ADAASQVLLGSGLTILSQPLMYVK M V 99.7% 36.4 25.7 17.2 28.3 0 0 2 0 1 2,533.3585 5,854.93 5,042.10 2 25 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Profilin-2 OS=Mus musculus OX=10090 GN=Pfn2 PE=1 SV=3 Q9JJV2 Pfn2 uniprot_Mus-musculus_SP.fasta 15,032.1 98.6% 1 1 2 0.00760% 10.00% SQGGEPTYNVAVGR K A 99.7% 66.3 25.8 19.8 58.2 0 2 0 0 2 1,434.6972 2,028.05 35,672.1 92 105 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Leukocyte surface antigen CD47 OS=Mus musculus OX=10090 GN=Cd47 PE=1 SV=2 Q61735 Cd47 uniprot_Mus-musculus_SP.fasta 33,098.9 98.6% 1 1 2 0.00760% 4.62% ISVSDLINGIASLK K M 99.7% 64.7 25.0 13.1 61.3 0 2 0 0 2 1,429.8262 5,026.03 16,251.1 86 99 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% ADLEMQIESLKEELAYLKK R N 96.7% 19.8 26.8 18.4 19.0 0 0 1 0 2 2,251.1893 4,452.08 19,800.3 239 257 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% EVATNSELVQSGK R S 99.7% 92.2 26.6 13.2 91.1 0 2 0 0 2 1,361.6907 1,620.09 41,182.5 322 334 Empty true Q9QWL7 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% TRLEQEIATYR K R 99.7% 40.2 26.1 13.0 37.8 0 1 0 0 2 1,379.7278 2,552.86 34,251.7 412 422 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% TRLEQEIATYRR K L 99.6% 24.2 25.8 15.4 22.7 0 0 2 0 2 1,535.8289 2,334.67 204898 412 423 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% VLDELTLAR R A 99.7% 60.6 25.6 17.1 51.5 0 3 0 0 2 1,029.5940 2,892.06 317497 230 238 Empty true Q9QWL7,Q6IFX2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0456% 12.8% VTMQNLNDR K L 99.7% 72.7 25.0 24.7 0.000 0 3 0 0 2 1,106.5260 1,009.20 352278 123 131 Empty true Q9Z2K1,P02535 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) AP-2 complex subunit alpha-2 OS=Mus musculus OX=10090 GN=Ap2a2 PE=1 SV=2 P17427 Ap2a2 uniprot_Mus-musculus_SP.fasta 104,019.4 100.0% 3 3 5 0.0190% 5.22% ACNQLGQFLQHR R E 99.7% 42.2 25.1 13.6 33.2 0 0 2 0 2 1,471.7224 2,845.11 108562 329 340 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) AP-2 complex subunit alpha-2 OS=Mus musculus OX=10090 GN=Ap2a2 PE=1 SV=2 P17427 Ap2a2 uniprot_Mus-musculus_SP.fasta 104,019.4 100.0% 3 3 5 0.0190% 5.22% IIGFGSALLEEVDPNPANFVGAGIIHTK K T 99.4% 35.7 25.6 0.000 2.14 0 0 1 0 2 2,880.5146 4,916.63 10,226.8 869 896 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) AP-2 complex subunit alpha-2 OS=Mus musculus OX=10090 GN=Ap2a2 PE=1 SV=2 P17427 Ap2a2 uniprot_Mus-musculus_SP.fasta 104,019.4 100.0% 3 3 5 0.0190% 5.22% NADVELQQR K A 99.4% 35.3 25.0 20.0 21.9 0 2 0 0 2 1,072.5382 1,420.29 64,037.6 570 578 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 4 4 8 0.0304% 11.2% ALGVLAQLIWSR R A 99.7% 68.2 25.0 13.7 65.9 0 2 0 0 2 1,326.7893 4,828.62 95,779.9 429 440 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 4 4 8 0.0304% 11.2% EGSSIGAIDSR R L 99.7% 73.7 25.1 18.7 55.7 0 2 0 0 2 1,091.5328 1,686.70 673989 223 233 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 4 4 8 0.0304% 11.2% GLVYETSVLDPDEGIRFR K G 99.7% 43.1 26.9 0.000 40.7 0 0 3 0 2 2,066.0555 3,669.13 202993 77 94 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 4 4 8 0.0304% 11.2% VVPGYGHAVLR R K 99.7% 56.8 25.0 15.9 51.9 0 1 0 0 2 1,167.6633 2,039.30 105723 341 351 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% IVSNASCTTNCLAPLAK K V 99.7% 98.8 27.5 13.0 98.8 0 2 0 0 2 1,819.9042 2,561.30 20,877.4 144 160 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% LEKPAKYDDIKK R V 99.7% 44.0 25.0 21.1 28.0 0 0 3 0 2 1,447.8158 1,249.58 151041 247 258 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% LISWYDNEYGYSNR K V 99.7% 64.0 25.0 0.000 64.0 0 1 0 0 2 1,779.7972 3,316.23 25,849.5 308 321 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% VGVNGFGR K I 99.0% 41.7 25.0 25.4 29.8 0 1 0 0 2 806.4156 2,070.57 100245 4 11 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% VIHDNFGIVEGLMTTVHAITATQK K T 99.7% 79.6 26.9 0.000 78.5 0 0 8 0 2 2,595.3602 5,048.65 147786 161 184 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% VKVGVNGFGR M I 99.7% 42.4 25.0 13.4 42.4 0 3 0 0 1 1,033.5790 2,021.89 204361 2 11 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus OX=10090 GN=Gapdh PE=1 SV=2 P16858 Gapdh uniprot_Mus-musculus_SP.fasta 35,810.1 100.0% 7 9 20 0.0760% 26.7% VVDLMAYMASKE R - 99.7% 77.1 25.0 0.000 74.0 0 2 0 0 2 1,388.6437 2,402.56 60,348.7 322 333 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus OX=10090 GN=Cand1 PE=1 SV=2 Q6ZQ38 Cand1 uniprot_Mus-musculus_SP.fasta 136,337.1 99.3% 1 1 2 0.00760% 1.14% ISGSILNELIGLVR K S 99.7% 54.3 25.0 14.5 54.3 0 2 0 0 2 1,483.8844 5,415.99 12,877.8 730 743 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heat shock 70 kDa protein 12A OS=Mus musculus OX=10090 GN=Hspa12a PE=1 SV=1 Q8K0U4 Hspa12a uniprot_Mus-musculus_SP.fasta 74,873.4 99.5% 1 1 1 0.00380% 1.93% ADKEAGGGDAGPR M E 95.2% 29.2 25.0 0.000 29.2 0 1 0 0 1 1,242.5712 947.533 8,835.50 2 14 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ubiquitin thioesterase OTUB1 OS=Mus musculus OX=10090 GN=Otub1 PE=1 SV=2 Q7TQI3 Otub1 uniprot_Mus-musculus_SP.fasta 31,270.5 98.6% 1 1 4 0.0152% 7.01% AFGFSHLEALLDDSKELQR R F 99.7% 57.4 27.8 13.2 53.4 0 0 4 0 2 2,176.1035 4,291.96 102024 95 113 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 5 5 13 0.0494% 12.7% LGPALATGNVVVMK K V 99.7% 59.0 25.0 0.000 51.6 0 2 0 0 2 1,369.7873 3,111.80 82,248.2 198 211 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 5 5 13 0.0494% 12.7% LLCGGGAAADR K G 99.7% 69.0 25.4 22.2 62.8 0 2 0 0 2 1,060.5206 1,407.40 94,901.4 386 396 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 5 5 13 0.0494% 12.7% TFVQENVYDEFVER R S 99.7% 93.8 25.0 0.000 90.6 0 2 0 0 2 1,774.8282 3,723.40 46,850.5 327 340 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 5 5 13 0.0494% 12.7% VAEQTPLTALYVANLIK K E 99.7% 77.1 25.0 0.000 75.1 0 3 0 0 2 1,844.0529 4,630.13 44,901.9 212 228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 5 5 13 0.0494% 12.7% YGLAAAVFTK K D 99.7% 58.9 25.0 16.5 48.9 0 4 0 0 2 1,040.5775 3,147.73 194781 444 453 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 4 4 7 0.0266% 17.1% AGVLAGHDNR R V 99.7% 51.1 25.0 13.4 48.2 0 2 0 0 2 1,009.5174 930.106 73,341.8 305 314 Empty true P62880 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 4 4 7 0.0266% 17.1% KACADATLSQITNNIDPVGR R I 99.5% 29.0 27.6 0.000 29.0 0 0 2 0 2 2,144.0767 3,296.27 95,382.6 23 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 4 4 7 0.0266% 17.1% LLVSASQDGK R L 96.0% 29.8 26.6 22.7 15.4 0 1 0 0 2 1,017.5576 1,599.92 60,898.7 69 78 Empty true P62880 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 4 4 7 0.0266% 17.1% SELDQLRQEAEQLKNQIR M D 99.7% 42.3 27.4 13.6 31.9 0 0 2 0 1 2,240.1632 4,226.71 54,534.4 2 19 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% ASTEGANNMPK M Q 99.7% 46.8 25.0 20.3 3.69 0 6 0 0 1 1,178.4994 954.942 124516 2 12 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% CLEDNLGIDKR R V 99.7% 32.1 25.8 18.8 22.3 0 0 2 0 2 1,332.6579 2,198.88 204030 373 383 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% KNDEVSSLDAFLDLIR K N 99.7% 57.4 27.3 0.000 53.5 0 1 2 0 2 1,834.9547 4,876.76 43,700.3 158 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% MHDSHLSSDEPK R H 99.7% 51.6 25.0 0.000 48.0 0 1 2 0 2 1,398.5956 784.357 152329 18 29 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% MQEDIEMTK R T 99.7% 62.3 25.0 27.1 49.0 0 4 0 0 2 1,156.4863 1,002.37 171147 509 517 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% NDEVSSLDAFLDLIR K N 99.7% 36.2 27.0 21.3 33.3 0 0 1 0 2 1,706.8597 5,245.98 9,696.80 159 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% NLFPENLVQACFQQIQTVTK R K 99.7% 37.5 27.8 13.3 34.8 0 0 2 0 2 2,378.2175 4,859.17 21,981.2 174 193 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% SADCSVEEEPWKR K E 99.2% 28.6 25.0 14.9 21.6 0 0 1 0 2 1,592.7010 2,086.67 61,248.8 558 570 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% SELDTIDSQHR K M 99.7% 47.5 25.0 21.6 43.0 0 2 2 0 2 1,300.6129 1,722.27 393633 498 508 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% TQSIYDDKNHR K E 97.3% 18.1 25.4 14.5 12.7 0 0 2 0 2 1,376.6554 922.513 86,844.4 518 528 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 11 15 31 0.118% 23.4% TSVNVVGDSFGAGIVYHLSK R S 99.7% 40.3 27.5 13.2 28.4 0 0 3 0 2 2,050.0604 3,781.22 785880 478 497 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% AILVDLEPGTMDSVR R S 99.7% 56.8 27.0 17.6 53.6 0 3 0 0 2 1,631.8312 3,227.20 70,835.4 63 77 Empty false P99024,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% ALTVPELTQQMFDAK R N 99.7% 94.3 26.9 22.0 31.4 0 3 0 0 2 1,707.8625 3,333.96 77,992.8 283 297 Empty false Q922F4,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% EIVHIQAGQCGNQIGAK R F 99.7% 52.7 27.3 14.9 0.000 0 0 2 0 2 1,822.9231 2,120.32 78,971.5 3 19 Empty false P99024,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% EVDEQMLAIQSK K N 99.7% 78.3 25.9 19.2 66.3 0 2 0 0 2 1,406.6834 2,027.72 42,768.1 325 336 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% FPGQLNADLR R K 99.7% 58.4 26.4 24.9 45.1 0 4 0 0 2 1,130.5954 2,749.21 447073 242 251 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% FPGQLNADLRK R L 99.7% 36.7 26.4 20.6 19.6 0 2 5 0 2 1,258.6904 2,360.12 1373550 242 252 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% GHYTEGAELVDSVLDVVR K K 99.7% 111 27.2 31.3 89.4 0 3 2 0 2 1,958.9819 4,497.05 765490 104 121 Empty false P99024,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% GHYTEGAELVDSVLDVVRK K E 99.7% 73.9 27.8 19.5 71.6 0 0 4 0 2 2,087.0769 4,245.10 160394 104 122 Empty false P99024,Q922F4,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% IMNTFSVVPSPK R V 99.7% 83.9 26.2 17.8 70.3 0 2 0 0 2 1,335.6978 2,738.44 276769 163 174 Empty false P99024,Q9D6F9,P68372 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% ISEQFTAMFR R R 99.7% 75.5 25.0 16.4 63.5 0 5 0 0 2 1,245.5933 2,920.93 1302230 381 390 Empty false P99024,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% ISVYYNEASSHK R Y 99.7% 28.5 25.0 15.6 19.6 0 0 2 0 2 1,397.6694 1,866.59 259486 47 58 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% KLAVNMVPFPR R L 99.7% 54.2 25.3 13.8 49.1 0 2 0 0 2 1,287.7243 2,713.46 80,453.7 252 262 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% LATPTYGDLNHLVSATMSGVTTSLR K F 99.7% 55.7 27.9 15.5 53.6 0 0 2 0 2 2,621.3242 3,966.90 46,908.3 217 241 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% LAVNMVPFPR K L 99.7% 64.9 26.2 21.2 58.2 0 6 0 0 2 1,159.6293 3,073.90 1111570 253 262 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% LHFFMPGFAPLTAR R G 99.7% 50.0 26.7 13.1 36.0 0 2 3 0 2 1,620.8357 3,812.56 155642 263 276 Empty true Q922F4 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% MREIVHIQAGQCGNQIGAK - F 99.7% 56.1 27.4 16.1 0.000 0 0 4 0 2 2,126.0596 1,998.24 274344 1 19 Empty false P99024,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% MSMKEVDEQMLAIQSK R N 99.7% 33.3 25.0 13.1 23.3 0 0 1 0 2 1,915.8812 1,861.35 70,919.7 321 336 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% MSSTFIGNSTAIQELFK K R 99.7% 87.9 27.3 14.5 85.2 0 1 0 0 2 1,889.9315 4,302.05 11,483.5 363 379 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% MSSTFIGNSTAIQELFKR K I 99.7% 38.1 27.3 0.000 20.0 0 0 3 0 2 2,046.0326 4,166.00 237874 363 380 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% NMMAACDPR K H 98.0% 29.7 25.0 0.000 29.7 0 1 0 0 2 1,097.4173 784.521 9,104.40 298 306 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% NSSYFVEWIPNNVK K V 99.7% 70.6 26.8 15.1 68.9 0 2 0 0 2 1,696.8328 3,962.02 320273 337 350 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% RISEQFTAMFR K R 97.2% 29.1 25.7 16.9 23.2 0 1 0 0 2 1,401.6944 2,652.18 41,506.3 380 390 Empty false P99024,Q9D6F9,P68372,Q7TMM9 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 100.0% 8 11 18 0.0684% 50.7% YLTVATVFR R G 99.7% 39.3 25.0 14.3 31.0 0 2 0 0 2 1,069.6040 3,453.85 147346 310 318 Empty true Q922F4 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptophysin OS=Mus musculus OX=10090 GN=Syp PE=1 SV=2 Q62277 Syp uniprot_Mus-musculus_SP.fasta 34,024.6 100.0% 3 4 7 0.0266% 9.24% LHQVYFDAPSCVK R G 99.7% 51.5 26.2 17.2 43.1 0 3 1 0 2 1,563.7625 2,560.92 110966 77 89 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptophysin OS=Mus musculus OX=10090 GN=Syp PE=1 SV=2 Q62277 Syp uniprot_Mus-musculus_SP.fasta 34,024.6 100.0% 3 4 7 0.0266% 9.24% MATDPENIIK K E 99.7% 44.8 25.9 15.4 32.2 0 2 0 0 2 1,147.5666 2,167.71 278528 170 179 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptophysin OS=Mus musculus OX=10090 GN=Syp PE=1 SV=2 Q62277 Syp uniprot_Mus-musculus_SP.fasta 34,024.6 100.0% 3 4 7 0.0266% 9.24% MATDPENIIKEMPMCR K Q 97.5% 17.5 25.0 13.5 17.5 0 0 1 0 2 1,983.8646 2,335.98 116597 170 185 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0570% 5.18% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 199 207 Empty false Q3TTY5,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0570% 5.18% FLEQQNQVLQTK R W 99.7% 82.6 26.5 20.2 69.8 0 5 0 0 2 1,475.7854 2,414.25 215818 208 219 Empty true Q6NXH9,Q6IFZ6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0570% 5.18% TNAENEFVTIK R K 99.7% 41.2 25.6 0.000 40.5 0 2 0 0 2 1,265.6372 2,559.62 231216 286 296 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0570% 5.18% TNAENEFVTIKK R D 99.7% 80.1 25.7 13.3 71.8 0 4 4 0 2 1,393.7322 2,098.40 1199010 286 297 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit gamma, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1c PE=1 SV=1 Q91VR2 Atp5f1c uniprot_Mus-musculus_SP.fasta 32,887.4 98.6% 1 1 2 0.00760% 4.03% VYGTGSLALYEK R A 99.7% 58.5 25.9 13.2 58.5 0 2 0 0 2 1,300.6784 2,842.99 68,972.8 68 79 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% DLQSAEKEEQEK R L 99.7% 40.6 25.0 22.7 25.0 0 1 0 0 2 1,433.6756 1,354.80 6,810.60 261 272 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% LGDICFSLR K Y 99.7% 47.3 25.0 21.7 34.3 0 1 0 0 2 1,080.5508 3,394.17 26,885.3 273 281 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% LTVVILEAK K N 99.7% 43.6 25.0 18.2 13.6 0 2 0 0 2 985.6293 3,135.08 87,691.4 289 297 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% MDVGGLSDPYVK K I 98.9% 39.0 25.0 15.7 37.1 0 1 0 0 2 1,296.6143 2,546.39 35,307.6 302 313 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% TLNPVFNEQFTFK K V 99.7% 53.5 26.2 0.000 47.6 0 2 0 0 2 1,584.8057 3,809.80 55,519.9 201 213 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptotagmin-1 OS=Mus musculus OX=10090 GN=Syt1 PE=1 SV=1 P46096 Syt1 uniprot_Mus-musculus_SP.fasta 47,418.9 100.0% 6 6 9 0.0342% 16.2% VFVGYNSTGAELR K H 99.7% 84.9 25.0 0.000 82.9 0 2 0 0 2 1,412.7168 2,714.81 49,211.2 376 388 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium- and chloride-dependent GABA transporter 3 OS=Mus musculus OX=10090 GN=Slc6a11 PE=1 SV=2 P31650 Slc6a11 uniprot_Mus-musculus_SP.fasta 69,963.1 100.0% 1 1 3 0.0114% 2.55% GSETLGGGGGGAAGTR R E 99.7% 54.1 25.0 18.9 39.4 0 3 0 0 2 1,304.6192 1,127.10 39,674.5 20 35 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Suclg1 PE=1 SV=4 Q9WUM5 Suclg1 uniprot_Mus-musculus_SP.fasta 36,155.2 98.6% 1 1 1 0.00380% 4.62% LIGPNCPGVINPGECK R I 99.7% 73.9 26.5 14.1 69.4 0 1 0 0 2 1,724.8462 2,645.70 13,098.8 167 182 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium- and chloride-dependent GABA transporter 1 OS=Mus musculus OX=10090 GN=Slc6a1 PE=1 SV=2 P31648 Slc6a1 uniprot_Mus-musculus_SP.fasta 67,003.9 98.6% 1 1 3 0.0114% 3.51% VADGQISTEVSEAPVASDKPK K T 99.7% 69.0 27.5 14.5 67.1 0 0 3 0 2 2,128.0770 2,262.85 92,802.6 8 28 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphatidylethanolamine-binding protein 1 OS=Mus musculus OX=10090 GN=Pebp1 PE=1 SV=3 P70296 Pebp1 uniprot_Mus-musculus_SP.fasta 20,830.5 100.0% 2 2 3 0.0114% 20.9% GNDISSGTVLSDYVGSGPPSGTGLHR K Y 99.7% 39.4 27.6 13.2 38.8 0 0 1 0 2 2,530.2171 3,234.47 22,403.5 94 119 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphatidylethanolamine-binding protein 1 OS=Mus musculus OX=10090 GN=Pebp1 PE=1 SV=3 P70296 Pebp1 uniprot_Mus-musculus_SP.fasta 20,830.5 100.0% 2 2 3 0.0114% 20.9% VDYAGVTVDELGK R V 99.7% 55.8 26.3 13.7 47.7 0 2 0 0 2 1,365.6898 2,999.52 75,968.7 27 39 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 2 OS=Mus musculus OX=10090 GN=Eef2 PE=1 SV=2 P58252 Eef2 uniprot_Mus-musculus_SP.fasta 95,316.0 99.9% 1 1 1 0.00380% 1.17% GEGQLSAAER K A 99.0% 32.8 25.0 20.8 22.4 0 1 0 0 2 1,017.4960 1,215.48 27,820.0 240 249 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Superoxide dismutase [Mn], mitochondrial OS=Mus musculus OX=10090 GN=Sod2 PE=1 SV=3 P09671 Sod2 uniprot_Mus-musculus_SP.fasta 24,603.2 100.0% 2 2 4 0.0152% 10.4% GDVTTQVALQPALK K F 99.7% 54.3 25.0 18.6 47.3 0 2 0 0 2 1,440.8059 2,665.10 51,315.1 76 89 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Superoxide dismutase [Mn], mitochondrial OS=Mus musculus OX=10090 GN=Sod2 PE=1 SV=3 P09671 Sod2 uniprot_Mus-musculus_SP.fasta 24,603.2 100.0% 2 2 4 0.0152% 10.4% GELLEAIKR K D 99.1% 35.3 25.0 35.7 23.1 0 2 0 0 2 1,028.6100 2,376.17 160760 115 123 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Vesicular glutamate transporter 1 OS=Mus musculus OX=10090 GN=Slc17a7 PE=1 SV=2 Q3TXX4 Slc17a7 uniprot_Mus-musculus_SP.fasta 61,637.5 100.0% 1 1 2 0.00760% 1.96% SRHIMSTTNVR R K 99.7% 56.0 26.5 22.1 45.3 0 0 2 0 2 1,317.6692 787.007 37,903.5 367 377 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit d 1 OS=Mus musculus OX=10090 GN=Atp6v0d1 PE=1 SV=2 P51863 Atp6v0d1 uniprot_Mus-musculus_SP.fasta 40,302.8 100.0% 4 4 6 0.0228% 10.5% ADDYEQVK R N 98.0% 33.8 25.0 18.8 22.3 0 2 0 0 2 967.4368 1,173.72 128412 258 265 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit d 1 OS=Mus musculus OX=10090 GN=Atp6v0d1 PE=1 SV=2 P51863 Atp6v0d1 uniprot_Mus-musculus_SP.fasta 40,302.8 100.0% 4 4 6 0.0228% 10.5% AYLESFYK K F 95.9% 27.3 26.0 22.4 19.8 0 1 0 0 2 1,020.5036 2,928.06 66,336.3 188 195 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit d 1 OS=Mus musculus OX=10090 GN=Atp6v0d1 PE=1 SV=2 P51863 Atp6v0d1 uniprot_Mus-musculus_SP.fasta 40,302.8 100.0% 4 4 6 0.0228% 10.5% LYPEGLAQLAR R A 99.7% 51.6 26.1 20.1 36.7 0 2 0 0 2 1,230.6842 3,309.16 462940 247 257 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit d 1 OS=Mus musculus OX=10090 GN=Atp6v0d1 PE=1 SV=2 P51863 Atp6v0d1 uniprot_Mus-musculus_SP.fasta 40,302.8 100.0% 4 4 6 0.0228% 10.5% NVADYYPEYK K L 98.7% 31.8 25.0 0.000 26.3 0 1 0 0 2 1,261.5735 2,494.27 50,656.0 266 275 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Protein kinase C and casein kinase substrate in neurons protein 1 OS=Mus musculus OX=10090 GN=Pacsin1 PE=1 SV=1 Q61644 Pacsin1 uniprot_Mus-musculus_SP.fasta 50,575.4 100.0% 2 2 2 0.00760% 4.54% AYAQQLTDWAK K R 99.7% 45.9 25.5 18.2 37.9 0 1 0 0 2 1,294.6427 3,022.39 38,437.4 52 62 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Protein kinase C and casein kinase substrate in neurons protein 1 OS=Mus musculus OX=10090 GN=Pacsin1 PE=1 SV=1 Q61644 Pacsin1 uniprot_Mus-musculus_SP.fasta 50,575.4 100.0% 2 2 2 0.00760% 4.54% GADAQEDLR R W 97.1% 27.7 25.0 13.5 25.3 0 1 0 0 2 974.4539 1,110.55 53,872.6 274 282 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% FFLENGKHDEAWMVLK R Q 98.7% 22.3 26.5 18.0 11.0 0 0 1 0 2 1,980.9526 3,593.02 54,642.4 360 375 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% GGLSDGEGPPGGRGEAQR R R 99.7% 62.8 25.5 16.3 54.2 0 0 4 0 2 1,696.8001 1,321.82 411210 124 141 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% GGQYFNDKFIGLR R L 99.7% 46.7 26.1 0.000 45.1 0 1 2 0 2 1,514.7752 3,163.68 216531 508 520 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% HLQAVDYAAR R T 96.5% 29.3 25.0 0.000 20.1 0 1 0 0 2 1,143.5905 1,697.29 63,598.2 474 483 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% TIHQEDELIEIQSDTGTWYQR K W 99.7% 65.5 27.3 15.6 65.5 0 0 2 0 2 2,562.2110 3,542.94 30,055.1 399 419 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 100.0% 6 7 13 0.0494% 11.6% VFSVTHIK R T 99.0% 40.2 25.7 18.0 24.5 0 2 0 0 2 930.5407 2,017.80 105120 391 398 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-actinin-1 OS=Mus musculus OX=10090 GN=Actn1 PE=1 SV=1 Q7TPR4 Actn1 uniprot_Mus-musculus_SP.fasta 103,072.0 100.0% 3 3 5 0.0190% 4.04% FAIQDISVEETSAK R E 99.7% 39.8 26.0 0.000 39.8 0 1 0 0 2 1,537.7745 3,175.22 17,603.8 134 147 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-actinin-1 OS=Mus musculus OX=10090 GN=Actn1 PE=1 SV=1 Q7TPR4 Actn1 uniprot_Mus-musculus_SP.fasta 103,072.0 100.0% 3 3 5 0.0190% 4.04% LASDLLEWIR K R 99.7% 69.2 25.6 22.8 60.0 0 2 0 0 2 1,215.6733 4,424.72 27,999.4 282 291 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-actinin-1 OS=Mus musculus OX=10090 GN=Actn1 PE=1 SV=1 Q7TPR4 Actn1 uniprot_Mus-musculus_SP.fasta 103,072.0 100.0% 3 3 5 0.0190% 4.04% VGWEQLLTTIAR R T 99.7% 65.8 25.3 23.0 59.1 0 2 0 0 2 1,386.7741 4,791.48 47,194.8 715 726 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutathione S-transferase Mu 1 OS=Mus musculus OX=10090 GN=Gstm1 PE=1 SV=2 P10649 Gstm1 uniprot_Mus-musculus_SP.fasta 25,971.9 100.0% 2 2 4 0.0152% 13.3% KHHLDGETEEER R I 99.7% 72.3 25.0 19.2 63.6 0 0 2 0 2 1,479.6824 774.491 93,910.5 83 94 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glutathione S-transferase Mu 1 OS=Mus musculus OX=10090 GN=Gstm1 PE=1 SV=2 P10649 Gstm1 uniprot_Mus-musculus_SP.fasta 25,971.9 100.0% 2 2 4 0.0152% 13.3% LGLDFPNLPYLIDGSHK K I 99.7% 42.3 26.7 17.0 38.2 0 0 2 0 2 1,899.0014 4,515.88 46,242.3 53 69 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs1 PE=1 SV=2 Q91VD9 Ndufs1 uniprot_Mus-musculus_SP.fasta 79,777.6 100.0% 2 2 2 0.00760% 2.61% ILQDIASGR K H 99.7% 53.4 25.1 16.0 25.4 0 1 0 0 2 972.5474 2,025.57 66,471.5 451 459 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs1 PE=1 SV=2 Q91VD9 Ndufs1 uniprot_Mus-musculus_SP.fasta 79,777.6 100.0% 2 2 2 0.00760% 2.61% SATYVNTEGR K A 98.3% 35.6 25.0 13.1 26.9 0 1 0 0 2 1,097.5221 1,287.26 19,403.5 593 602 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome c oxidase subunit 2 OS=Mus musculus OX=10090 GN=Mtco2 PE=1 SV=1 P00405 Mtco2 uniprot_Mus-musculus_SP.fasta 25,977.5 100.0% 1 1 1 0.00380% 7.49% LLEVDNRVVLPMELPIR R M 99.7% 42.1 25.0 14.2 24.1 0 0 1 0 2 2,006.1469 4,232.05 38,262.4 135 151 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1 P63328 Ppp3ca uniprot_Mus-musculus_SP.fasta 58,645.7 100.0% 3 3 6 0.0228% 6.72% EVFDNDGKPR K V 96.0% 29.2 25.4 15.7 25.6 0 1 0 0 2 1,176.5645 1,260.59 24,190.9 33 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1 P63328 Ppp3ca uniprot_Mus-musculus_SP.fasta 58,645.7 100.0% 3 3 6 0.0228% 6.72% HLTEYFTFKQECK R I 99.7% 26.4 25.3 13.1 26.4 0 0 3 0 2 1,730.8208 2,659.69 128104 155 167 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1 P63328 Ppp3ca uniprot_Mus-musculus_SP.fasta 58,645.7 100.0% 3 3 6 0.0228% 6.72% LFEVGGSPANTR K Y 99.7% 59.7 26.5 14.5 48.7 0 2 0 0 2 1,247.6379 2,362.75 82,278.4 101 112 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Immunoglobulin superfamily member 8 OS=Mus musculus OX=10090 GN=Igsf8 PE=1 SV=2 Q8R366 Igsf8 uniprot_Mus-musculus_SP.fasta 65,009.7 98.6% 1 1 2 0.00760% 1.64% VASGDLQVQR R L 99.7% 53.0 25.1 14.8 44.6 0 2 0 0 2 1,072.5746 1,545.37 37,314.5 93 102 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Visinin-like protein 1 OS=Mus musculus OX=10090 GN=Vsnl1 PE=1 SV=2 P62761 Vsnl1 uniprot_Mus-musculus_SP.fasta 22,143.4 99.2% 1 1 4 0.0152% 6.28% VEMLEIIEAIYK R M 99.7% 77.9 25.0 0.000 77.9 0 4 0 0 2 1,450.7863 5,125.39 31,644.5 119 130 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 4 4 8 0.0304% 10.4% IQEVDAQMLR R D 99.7% 55.0 26.6 29.2 46.0 0 2 0 0 2 1,218.6149 1,989.51 81,051.9 433 442 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 4 4 8 0.0304% 10.4% LCTSATESEVTR R G 99.7% 61.5 25.0 23.7 55.7 0 2 0 0 2 1,353.6315 1,634.56 48,935.2 379 390 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 4 4 8 0.0304% 10.4% NALVSHLDGTTPVCEDIGR R S 99.5% 30.0 27.1 13.6 29.7 0 0 2 0 2 2,053.9974 2,894.75 77,565.1 397 415 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 4 4 8 0.0304% 10.4% TDLTDYLNR R H 99.7% 56.7 25.0 13.6 43.5 0 2 0 0 2 1,110.5427 2,951.66 93,342.3 214 222 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Programmed cell death 6-interacting protein OS=Mus musculus OX=10090 GN=Pdcd6ip PE=1 SV=3 Q9WU78 Pdcd6ip uniprot_Mus-musculus_SP.fasta 96,026.6 98.6% 1 1 2 0.00760% 3.34% EPTVDISPDTVGTLSLIMLAQAQEVFFLK R A 99.7% 49.3 26.3 0.000 48.4 0 0 2 0 2 3,162.6647 6,534.28 5,137.90 174 202 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus OX=10090 GN=Idh3g PE=1 SV=1 P70404 Idh3g uniprot_Mus-musculus_SP.fasta 42,785.6 100.0% 2 2 2 0.00760% 9.16% ENTEGEYSSLEHESVAGVVESLK R I 99.7% 34.5 26.5 0.000 34.5 0 0 1 0 2 2,493.1627 3,800.60 28,730.7 168 190 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus OX=10090 GN=Idh3g PE=1 SV=1 P70404 Idh3g uniprot_Mus-musculus_SP.fasta 42,785.6 100.0% 2 2 2 0.00760% 9.16% TSLDLYANVIHCK R S 98.6% 22.4 26.8 0.000 15.2 0 0 1 0 2 1,533.7731 3,122.08 38,229.7 137 149 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Solute carrier family 12 member 5 OS=Mus musculus OX=10090 GN=Slc12a5 PE=1 SV=2 Q91V14 Slc12a5 uniprot_Mus-musculus_SP.fasta 126,273.1 99.6% 1 1 1 0.00380% 0.879% DLTTFLYHLR K I 99.7% 44.9 25.3 13.2 44.8 0 1 0 0 2 1,278.6842 4,278.66 22,797.1 897 906 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytosolic acyl coenzyme A thioester hydrolase OS=Mus musculus OX=10090 GN=Acot7 PE=1 SV=2 Q91V12 Acot7 uniprot_Mus-musculus_SP.fasta 42,536.0 97.9% 1 1 1 0.00380% 2.89% ATLWYVPLSLK K N 99.6% 38.2 25.0 0.000 35.4 0 1 0 0 2 1,290.7457 4,324.72 18,712.5 159 169 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% AGFAGDDAPR K A 99.7% 72.2 25.0 24.4 51.3 0 2 0 0 2 976.4484 1,483.18 275552 19 28 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% AVFPSIVGRPR R H 96.9% 27.7 25.0 0.000 27.7 0 1 0 0 2 1,198.7055 2,704.80 73,098.2 29 39 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% DSYVGDEAQSK K R 99.7% 58.5 25.0 15.4 52.9 0 1 0 0 2 1,198.5223 1,267.63 111124 51 61 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% DSYVGDEAQSKR K G 99.7% 62.9 25.0 19.6 60.2 0 2 2 0 2 1,354.6234 1,186.45 208240 51 62 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% EITALAPSTMK K I 96.4% 28.2 26.0 15.4 24.5 0 1 0 0 2 1,177.6135 1,969.42 89,847.9 316 326 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% GYSFTTTAER R E 99.7% 57.8 25.0 13.2 57.8 0 4 0 0 2 1,132.5269 2,113.55 449306 197 206 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% IWHHTFYNELR K V 99.7% 63.8 25.5 14.2 57.0 0 0 3 0 2 1,515.7491 2,679.67 396997 85 95 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% LCYVALDFEQEMATAASSSSLEK K S 99.7% 65.0 25.8 0.000 63.7 0 0 2 0 2 2,550.1739 4,607.83 137637 216 238 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% LDLAGRDLTDYLMK R I 99.5% 36.7 25.9 13.1 24.3 0 1 2 0 2 1,639.8364 3,498.51 167654 178 191 Empty true Q8BFZ3 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% QEYDESGPSIVHR K K 99.7% 27.2 25.0 0.000 26.7 0 0 2 0 2 1,516.7027 1,856.98 133150 360 372 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% QEYDESGPSIVHRK K C 99.7% 27.7 26.1 15.2 22.2 0 0 1 0 2 1,644.7977 1,590.63 33,486.8 360 373 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% SYELPDGQVITIGNER K F 99.7% 90.1 27.5 16.0 72.7 0 4 0 0 2 1,790.8921 3,443.54 109122 239 254 Empty true Q8BFZ3 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 13 15 30 0.114% 40.0% VAPEEHPVLLTEAPLNPK R A 99.7% 39.6 25.3 13.4 16.4 0 0 2 0 2 1,954.0646 2,973.17 281218 96 113 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 3 3 4 0.0152% 19.5% ADWSSLSR K D 96.8% 27.4 25.0 16.1 25.0 0 1 0 0 2 921.4424 2,257.20 55,605.1 68 75 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 3 3 4 0.0152% 19.5% IQFNESFAEMNR R G 99.7% 90.6 25.0 14.7 89.8 0 2 0 0 2 1,501.6740 2,771.39 57,772.2 84 95 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 3 3 4 0.0152% 19.5% SEDYAFPTYADRR K D 99.1% 22.5 25.0 13.0 19.5 0 0 1 0 2 1,590.7183 2,526.42 159058 30 42 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial OS=Mus musculus OX=10090 GN=Aldh6a1 PE=1 SV=1 Q9EQ20 Aldh6a1 uniprot_Mus-musculus_SP.fasta 57,916.3 98.6% 1 1 3 0.0114% 2.06% TLADAEGDVFR K G 99.7% 43.0 25.0 13.1 35.0 0 3 0 0 2 1,193.5798 2,780.47 213384 130 140 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Fascin OS=Mus musculus OX=10090 GN=Fscn1 PE=1 SV=4 Q61553 Fscn1 uniprot_Mus-musculus_SP.fasta 54,508.2 100.0% 1 1 1 0.00380% 2.03% KVTGTLDANR R S 99.5% 46.2 26.8 18.3 30.8 0 1 0 0 2 1,074.5903 1,007.63 14,999.3 399 408 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein H OS=Mus musculus OX=10090 GN=Hnrnph1 PE=1 SV=3 O35737 Hnrnph1 uniprot_Mus-musculus_SP.fasta 49,199.8 99.1% 1 1 1 0.00380% 3.56% HTGPNSPDTANDGFVR K L 98.6% 22.7 25.0 13.1 20.0 0 0 1 0 2 1,684.7675 1,752.68 27,052.5 99 114 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Clathrin coat assembly protein AP180 OS=Mus musculus OX=10090 GN=Snap91 PE=1 SV=1 Q61548 Snap91 uniprot_Mus-musculus_SP.fasta 91,852.9 98.6% 1 1 2 0.00760% 1.33% NTLFNLSNFLDK R S 99.7% 55.6 25.4 15.4 48.6 0 2 0 0 2 1,425.7373 4,544.33 36,121.3 101 112 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus OX=10090 GN=Uba1 PE=1 SV=1 Q02053 Uba1 uniprot_Mus-musculus_SP.fasta 117,810.3 97.7% 1 1 1 0.00380% 2.08% IIPAIATTTAAVVGLVCLELYK K V 99.5% 23.7 25.0 0.000 23.7 0 0 1 0 2 2,316.3250 6,253.53 3,313.60 890 911 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Polypyrimidine tract-binding protein 1 OS=Mus musculus OX=10090 GN=Ptbp1 PE=1 SV=2 P17225 Ptbp1 uniprot_Mus-musculus_SP.fasta 56,478.9 98.6% 1 2 2 0.00760% 3.42% VTPQSLFILFGVYGDVQR R V 99.7% 57.3 26.0 0.000 56.9 0 1 1 0 2 2,039.0962 5,273.27 13,257.3 347 364 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% ALEEANADLEVK R I 99.7% 75.6 26.4 29.5 15.4 0 2 0 0 2 1,301.6584 2,253.77 150721 114 125 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% DAEEWFFTKTEELNR K E 99.7% 37.1 25.0 13.3 29.7 0 0 2 0 2 1,914.8869 3,864.23 53,343.7 280 294 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% TKYETELNLR R M 99.0% 32.8 25.0 15.8 30.6 0 1 0 0 2 1,266.6689 2,160.06 82,054.4 181 190 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% TRLEQEIATYR K R 99.7% 40.2 26.1 13.0 37.8 0 1 0 0 2 1,379.7278 2,552.86 34,251.7 385 395 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% TRLEQEIATYRR K L 99.6% 24.2 25.8 15.4 22.7 0 0 2 0 2 1,535.8289 2,334.67 204898 385 396 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 5 0.0190% 12.8% VLDELTLAR R A 99.7% 60.6 25.6 17.1 51.5 0 3 0 0 2 1,029.5940 2,892.06 317497 203 211 Empty false Q9QWL7,Q61781 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Eukaryotic translation initiation factor 5A-1 OS=Mus musculus OX=10090 GN=Eif5a PE=1 SV=2 P63242 Eif5a uniprot_Mus-musculus_SP.fasta 16,832.7 98.6% 1 2 4 0.0152% 15.6% YDCGEEILITVLSAMTEEAAVAIK K A 99.7% 80.7 28.1 15.1 75.3 0 2 2 0 2 2,626.2993 6,549.37 60,849.6 127 150 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3 Q02257 Jup uniprot_Mus-musculus_SP.fasta 81,801.9 99.1% 1 1 4 0.0152% 2.42% TLVTQNSGVEALIHAILR K A 99.7% 41.1 25.0 13.1 41.1 0 0 4 0 2 1,935.1023 5,123.04 63,324.9 427 444 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 3 OS=Mus musculus OX=10090 GN=Vdac3 PE=1 SV=1 Q60931 Vdac3 uniprot_Mus-musculus_SP.fasta 30,754.0 100.0% 2 2 5 0.0190% 7.42% LSQNNFALGYK K A 99.7% 40.4 25.0 19.8 35.3 0 2 0 0 2 1,254.6477 2,668.70 84,697.9 164 174 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 3 OS=Mus musculus OX=10090 GN=Vdac3 PE=1 SV=1 Q60931 Vdac3 uniprot_Mus-musculus_SP.fasta 30,754.0 100.0% 2 2 5 0.0190% 7.42% LTLSALIDGK K N 99.7% 60.4 25.0 13.0 0.000 0 3 0 0 2 1,030.6145 3,691.54 92,421.6 257 266 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 100.0% 5 6 8 0.0304% 20.3% GFGFGLVK K L 97.0% 27.6 25.0 14.6 13.5 0 1 0 0 2 824.4666 3,366.41 42,590.9 33 40 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 100.0% 5 6 8 0.0304% 20.3% LTFDTTFSPNTGKK K S 99.6% 23.7 25.5 13.4 22.1 0 0 1 0 2 1,556.7957 2,727.17 48,183.4 109 122 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 100.0% 5 6 8 0.0304% 20.3% LTLSALVDGK K S 99.7% 64.5 25.0 19.7 60.6 0 1 0 0 2 1,016.5988 3,355.46 49,396.7 269 278 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 100.0% 5 6 8 0.0304% 20.3% SNFAVGYR R T 97.0% 27.6 25.0 21.7 24.8 0 1 0 0 2 913.4525 2,050.10 132178 179 186 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 100.0% 5 6 8 0.0304% 20.3% VNNSSLIGVGYTQTLRPGVK K L 99.7% 59.2 25.0 13.2 51.8 0 0 4 0 2 2,103.1558 3,047.30 255831 249 268 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1 Q8BMS1 Hadha uniprot_Mus-musculus_SP.fasta 82,671.5 100.0% 3 3 5 0.0190% 6.16% GFYIYQEGSK K N 97.5% 40.2 25.0 0.000 40.2 0 1 0 0 2 1,191.5681 2,674.25 34,199.6 635 644 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1 Q8BMS1 Hadha uniprot_Mus-musculus_SP.fasta 82,671.5 100.0% 3 3 5 0.0190% 6.16% LPAKPEVSSDEDVQYR R V 99.7% 90.3 27.3 15.2 80.4 0 0 2 0 2 1,832.9026 2,052.73 102956 661 676 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1 Q8BMS1 Hadha uniprot_Mus-musculus_SP.fasta 82,671.5 100.0% 3 3 5 0.0190% 6.16% TVLGVPEVLLGILPGAGGTQR K L 99.3% 23.6 25.0 0.000 23.6 0 0 2 0 2 2,047.1914 5,137.44 25,637.5 167 187 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 2 2 3 0.0114% 5.80% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 210 218 Empty false P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 2 2 3 0.0114% 5.80% GFSSGSAVVSGGSR R R 99.7% 103 25.0 15.9 89.6 0 2 0 0 2 1,254.6072 1,759.01 185998 23 36 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 2 2 3 0.0114% 5.80% KLLEGEECR R M 99.7% 42.7 25.8 13.4 42.7 0 2 0 0 2 1,133.5621 1,313.69 83,972.0 503 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 2 2 3 0.0114% 5.80% KYEDEINKR K T 95.9% 28.2 25.1 15.2 21.4 0 1 0 0 2 1,194.6114 1,051.32 11,283.4 288 296 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 2 2 3 0.0114% 5.80% LLEGEECR K M 99.0% 53.4 25.0 26.3 41.6 0 2 0 0 2 1,005.4671 1,410.53 158728 504 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 1 OS=Mus musculus OX=10090 GN=Crmp1 PE=1 SV=1 P97427 Crmp1 uniprot_Mus-musculus_SP.fasta 62,168.7 100.0% 2 2 2 0.00760% 5.77% KPFPEHLYQR R V 98.0% 25.3 26.2 13.4 19.4 0 0 1 0 2 1,314.6954 1,908.17 68,890.1 472 481 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 1 OS=Mus musculus OX=10090 GN=Crmp1 PE=1 SV=1 P97427 Crmp1 uniprot_Mus-musculus_SP.fasta 62,168.7 100.0% 2 2 2 0.00760% 5.77% QIGENLIVPGGVK K T 99.7% 51.6 25.0 19.3 51.3 0 2 0 0 2 1,323.7633 3,036.35 97,056.7 44 56 Empty false O08553 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydropyrimidinase-related protein 1 OS=Mus musculus OX=10090 GN=Crmp1 PE=1 SV=1 P97427 Crmp1 uniprot_Mus-musculus_SP.fasta 62,168.7 100.0% 2 2 2 0.00760% 5.77% SAADIIALAR K K 99.7% 70.9 25.8 26.6 45.8 0 1 0 0 2 1,000.5786 3,168.45 45,854.6 259 268 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Neurochondrin OS=Mus musculus OX=10090 GN=Ncdn PE=1 SV=1 Q9Z0E0 Ncdn uniprot_Mus-musculus_SP.fasta 78,897.1 100.0% 3 3 5 0.0190% 5.21% IFDAVGFTFPNR R L 99.6% 39.1 25.0 0.000 39.1 0 2 0 0 2 1,383.7056 3,897.36 109715 76 87 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Neurochondrin OS=Mus musculus OX=10090 GN=Ncdn PE=1 SV=1 Q9Z0E0 Ncdn uniprot_Mus-musculus_SP.fasta 78,897.1 100.0% 3 3 5 0.0190% 5.21% IPILSTFLTAR K G 97.7% 31.3 25.0 13.8 31.3 0 1 0 0 2 1,231.7410 4,498.79 16,588.1 130 140 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Neurochondrin OS=Mus musculus OX=10090 GN=Ncdn PE=1 SV=1 Q9Z0E0 Ncdn uniprot_Mus-musculus_SP.fasta 78,897.1 100.0% 3 3 5 0.0190% 5.21% LLSTSPALQGTPASR R G 99.7% 49.6 25.1 0.000 39.3 0 2 0 0 2 1,498.8225 2,394.58 33,359.8 579 593 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% AAYFGIYDTAK R G 99.6% 40.2 25.6 13.2 34.2 0 2 0 0 2 1,219.5994 3,038.43 94,982.6 189 199 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% DFLAGGVAAAISK K T 99.7% 78.2 25.5 18.4 47.7 0 2 0 0 2 1,219.6682 3,513.49 156344 11 23 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% EQGVLSFWR K G 99.6% 37.0 25.1 15.4 35.4 0 2 0 0 2 1,121.5738 3,772.01 135129 64 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% GAWSNVLR K G 98.8% 45.1 27.6 26.3 13.5 0 1 0 0 2 902.4842 2,757.19 41,748.5 273 280 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% GMGGAFVLVLYDEIK R K 99.7% 50.2 26.3 18.2 36.8 0 1 0 0 2 1,627.8403 4,713.95 11,493.4 281 295 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% GMGGAFVLVLYDEIKK R Y 99.7% 44.0 26.0 15.8 39.9 0 0 2 0 2 1,755.9353 4,400.38 150396 281 296 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% IPKEQGVLSFWR R G 95.8% 19.9 25.8 16.2 15.0 0 0 1 0 2 1,459.8057 3,556.15 28,867.9 61 72 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% LLLQVQHASK K Q 99.7% 41.2 25.0 14.9 29.0 0 2 0 0 2 1,136.6787 1,998.70 203811 34 43 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% TAVAPIER K V 99.0% 36.9 25.0 18.5 18.6 0 2 0 0 2 856.4887 1,455.39 417081 24 31 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% TDAAVSFAKDFLAGGVAAAISK M T 99.7% 48.8 26.9 13.1 48.8 0 0 2 0 1 2,152.1286 5,594.35 14,360.5 2 23 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% VKLLLQVQHASK R Q 99.7% 34.2 25.0 13.5 31.5 0 0 4 0 2 1,363.8421 2,194.28 306272 32 43 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 100.0% 5 5 9 0.0342% 33.9% YFPTQALNFAFK R D 99.7% 62.7 27.1 18.7 55.4 0 2 0 0 2 1,446.7416 4,210.57 112117 81 92 Empty false P48962 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 4 4 5 0.0190% 6.46% AIMNLDVEQYR K M 99.7% 56.0 25.0 18.6 53.8 0 2 0 0 2 1,367.6625 2,646.67 82,124.2 125 135 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 4 4 5 0.0190% 6.46% FHNLNAGPSR K T 96.0% 26.4 25.0 20.0 24.5 0 1 0 0 2 1,112.5595 1,362.88 26,225.5 454 463 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 4 4 5 0.0190% 6.46% LVQDYGLESEVAQHLAK R T 99.7% 29.0 27.0 15.0 26.6 0 0 1 0 2 1,899.9812 3,412.14 113238 483 499 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 4 4 5 0.0190% 6.46% VIFFLPWEK R M 94.7% 27.5 25.0 0.000 27.5 0 1 0 0 2 1,178.6609 4,666.27 13,939.7 340 348 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial OS=Mus musculus OX=10090 GN=Dlat PE=1 SV=2 Q8BMF4 Dlat uniprot_Mus-musculus_SP.fasta 67,942.6 99.8% 1 1 1 0.00380% 2.34% GLETIASDVVSLASK K A 99.7% 85.2 26.1 23.6 82.4 0 1 0 0 2 1,489.8109 4,544.98 19,910.1 528 542 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3 Q8CI94 Pygb uniprot_Mus-musculus_SP.fasta 96,732.5 100.0% 2 2 5 0.0190% 3.91% LKDFNVGDYIEAVLDR K N 99.6% 26.4 26.8 14.7 12.3 0 0 3 0 2 1,866.9598 4,869.69 46,110.3 255 270 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Glycogen phosphorylase, brain form OS=Mus musculus OX=10090 GN=Pygb PE=1 SV=3 Q8CI94 Pygb uniprot_Mus-musculus_SP.fasta 96,732.5 100.0% 2 2 5 0.0190% 3.91% LKQEYFVVAATLQDIIR R R 99.7% 26.5 25.0 16.4 26.5 0 0 2 0 2 2,007.1275 4,809.72 31,824.1 294 310 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1 P12960 Cntn1 uniprot_Mus-musculus_SP.fasta 113,390.8 99.3% 1 1 2 0.00760% 1.08% VQVTSQEYSAR R L 99.7% 39.9 25.0 18.3 37.4 0 2 0 0 2 1,267.6276 1,592.53 37,697.6 859 869 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% AAVPSGASTGIYEALELR R D 99.7% 112 26.9 15.5 110 0 2 0 0 2 1,804.9440 3,862.26 34,957.1 33 50 Empty false P17182 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% FGANAILGVSLAVCK K A 99.7% 50.5 25.3 13.0 46.2 0 6 0 0 2 1,519.8302 6,526.31 21,158.9 106 120 Empty false P17182 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% GNPTVEVDLYTAK R G 99.7% 45.2 26.1 13.6 43.9 0 2 0 0 2 1,406.7163 2,783.98 130543 16 28 Empty false P17182 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% IEEELGDEAR R F 99.7% 58.2 25.0 22.7 21.4 0 2 0 0 2 1,160.5431 1,741.11 68,765.5 413 422 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% SGETEDTFIADLVVGLCTGQIK R T 99.7% 95.4 27.8 0.000 91.4 0 2 3 0 2 2,353.1596 5,363.01 25,569.2 373 394 Empty false P17182 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% VNQIGSVTEAIQACK K L 99.7% 116 26.8 23.1 113 0 2 0 0 2 1,617.8266 2,931.78 46,287.9 344 358 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Gamma-enolase OS=Mus musculus OX=10090 GN=Eno2 PE=1 SV=2 P17183 Eno2 uniprot_Mus-musculus_SP.fasta 47,297.8 100.0% 3 3 5 0.0190% 25.1% YITGDQLGALYQDFVR R N 99.2% 50.4 27.5 16.5 44.5 0 1 0 0 2 1,858.9336 4,572.53 11,752.8 270 285 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% AAVPSGASTGIYEALELR R D 99.7% 112 26.9 15.5 110 0 2 0 0 2 1,804.9440 3,862.26 34,957.1 33 50 Empty true P17183 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% DATNVGDEGGFAPNILENKEALELLK K T 99.7% 54.5 28.3 15.4 47.4 0 0 3 0 2 2,757.3945 4,275.10 55,144.4 203 228 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% FGANAILGVSLAVCK K A 99.7% 50.5 25.3 13.0 46.2 0 6 0 0 2 1,519.8302 6,526.31 21,158.9 106 120 Empty true P17183 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% GNPTVEVDLYTAK R G 99.7% 45.2 26.1 13.6 43.9 0 2 0 0 2 1,406.7163 2,783.98 130543 16 28 Empty true P17183 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% GVSQAVEHINK K T 99.7% 40.5 25.0 15.0 34.4 0 2 0 0 2 1,181.6273 1,554.27 36,355.8 61 71 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% KVNVVEQEKIDK K L 99.5% 25.0 25.4 20.1 22.8 0 0 1 0 2 1,428.8058 1,379.80 49,547.6 81 92 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% SGETEDTFIADLVVGLCTGQIK R T 99.7% 95.4 27.8 0.000 91.4 0 2 3 0 2 2,353.1596 5,363.01 25,569.2 373 394 Empty true P17183 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% SGKYDLDFKSPDDPSR R Y 99.7% 32.7 25.0 17.8 32.7 0 0 2 0 2 1,826.8558 2,323.72 168597 254 269 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% VNQIGSVTESLQACK K L 99.7% 106 26.9 19.5 0.000 0 2 0 0 2 1,633.8215 2,707.18 26,669.0 344 358 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 10 11 27 0.103% 36.9% YITPDQLADLYK R S 99.3% 40.3 25.0 13.6 40.1 0 2 0 0 2 1,439.7419 3,727.08 132509 270 281 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) F-actin-capping protein subunit beta OS=Mus musculus OX=10090 GN=Capzb PE=1 SV=3 P47757 Capzb uniprot_Mus-musculus_SP.fasta 31,346.5 100.0% 2 2 2 0.00760% 10.8% SPWSNKYDPPLEDGAMPSAR R L 99.7% 27.9 25.0 13.3 26.8 0 0 1 0 2 2,234.0185 2,728.05 15,551.3 73 92 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) F-actin-capping protein subunit beta OS=Mus musculus OX=10090 GN=Capzb PE=1 SV=3 P47757 Capzb uniprot_Mus-musculus_SP.fasta 31,346.5 100.0% 2 2 2 0.00760% 10.8% STLNEIYFGK R T 99.7% 54.2 25.0 15.7 51.0 0 1 0 0 2 1,171.5994 3,034.11 43,319.9 226 235 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2 Q61425 Hadh uniprot_Mus-musculus_SP.fasta 34,464.7 98.6% 1 1 2 0.00760% 3.50% LLVPYLIEAVR R L 99.7% 60.9 25.0 17.9 54.7 0 2 0 0 2 1,285.7879 4,503.66 40,971.8 222 232 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphoglycerate kinase 1 OS=Mus musculus OX=10090 GN=Pgk1 PE=1 SV=4 P09411 Pgk1 uniprot_Mus-musculus_SP.fasta 44,551.1 100.0% 2 2 4 0.0152% 7.67% ALESPERPFLAILGGAK K V 99.7% 27.0 25.0 13.1 27.0 0 0 2 0 2 1,768.9958 4,044.44 72,921.9 200 216 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Phosphoglycerate kinase 1 OS=Mus musculus OX=10090 GN=Pgk1 PE=1 SV=4 P09411 Pgk1 uniprot_Mus-musculus_SP.fasta 44,551.1 100.0% 2 2 4 0.0152% 7.67% LGDVYVNDAFGTAHR K A 99.7% 48.0 26.4 17.1 44.3 0 0 2 0 2 1,634.7922 2,853.52 106877 157 171 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Mus musculus OX=10090 GN=Ndufv1 PE=1 SV=1 Q91YT0 Ndufv1 uniprot_Mus-musculus_SP.fasta 50,834.6 99.7% 1 1 2 0.00760% 2.59% KTSFGSLKDEDR K I 99.4% 26.3 25.1 19.0 16.9 0 0 2 0 2 1,382.6912 1,466.84 97,993.5 29 40 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptogyrin-3 OS=Mus musculus OX=10090 GN=Syngr3 PE=1 SV=1 Q8R191 Syngr3 uniprot_Mus-musculus_SP.fasta 24,561.0 100.0% 2 2 3 0.0114% 11.8% AGAAFDPVSFAR R R 99.7% 43.9 25.8 13.1 40.2 0 1 0 0 2 1,208.6058 3,251.81 105977 11 22 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptogyrin-3 OS=Mus musculus OX=10090 GN=Syngr3 PE=1 SV=1 Q8R191 Syngr3 uniprot_Mus-musculus_SP.fasta 24,561.0 100.0% 2 2 3 0.0114% 11.8% TTPGPGTAQAGDAAR R A 99.5% 36.0 25.0 16.2 31.6 0 2 0 0 2 1,370.6661 1,230.60 51,609.5 133 147 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0114% 8.22% SYEAYVLNIIR K F 99.7% 43.8 25.0 20.4 28.0 0 2 0 0 2 1,340.7208 4,149.51 85,403.5 97 107 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0114% 8.22% VAPPGLTQIPQIQK R T 99.5% 35.8 25.0 15.3 35.8 0 1 0 0 2 1,489.8740 3,095.13 57,430.6 72 85 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 3 3 5 0.0190% 16.3% IETELRDICNDVLSLLEK K F 99.7% 32.1 27.6 20.6 24.5 0 0 2 0 2 2,160.1220 5,227.54 20,202.3 86 103 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 3 3 5 0.0190% 16.3% NLLSVAYK R N 97.7% 29.8 25.0 13.2 29.8 0 1 0 0 2 907.5247 2,777.22 68,456.2 42 49 Empty true P68254,P61982,P62259 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 3 3 5 0.0190% 16.3% SVTEQGAELSNEER K N 99.7% 101 25.0 13.1 97.1 0 2 0 0 2 1,548.7136 1,743.45 31,383.5 28 41 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% EAYPGDVFYLHSR R L 99.7% 53.0 25.0 14.9 41.8 0 1 0 0 2 1,553.7383 3,059.50 22,865.3 335 347 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% GIRPAINVGLSVSR K V 98.6% 22.8 25.0 0.000 22.8 0 0 1 0 2 1,438.8489 2,799.98 42,898.6 403 416 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% HALIIYDDLSK K Q 99.7% 54.3 26.5 13.1 54.3 0 1 0 0 2 1,287.6945 2,880.34 48,526.2 306 316 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% ILGADTSVDLEETGR R V 99.5% 43.3 26.5 0.000 43.3 0 1 0 0 2 1,575.7863 2,832.49 11,866.8 59 73 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% LKEIVTNFLAGFEP K - 99.7% 40.5 25.2 0.000 39.7 0 1 0 0 2 1,577.8575 4,655.86 24,488.6 540 553 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% QGQYSPMAIEEQVAVIYAGVR K G 97.5% 24.3 28.0 13.8 22.2 0 0 1 0 2 2,309.1595 4,798.45 12,329.1 473 493 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% STVAQLVK R R 98.0% 34.8 25.0 19.4 32.2 0 2 0 0 2 845.5091 1,923.41 97,315.8 254 261 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% TGAIVDVPVGEELLGR R V 99.7% 40.4 25.0 13.1 35.5 0 1 0 0 2 1,624.8907 3,850.77 21,286.3 134 149 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 9 9 11 0.0418% 22.6% TSIAIDTIINQKR K F 99.7% 39.3 25.0 14.0 37.7 0 0 2 0 2 1,472.8433 2,987.77 69,521.7 219 231 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% AVVGEEALTSDDLLYLEFLQKFEK K N 99.7% 33.7 28.0 13.3 33.7 0 0 1 0 2 2,757.4236 5,085.58 6,414.30 437 460 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% AVVQVFEGTSGIDAK K K 99.7% 57.5 26.5 13.4 56.4 0 1 0 0 2 1,520.7956 3,004.20 21,553.5 94 108 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% HVLVILTDMSSYAEALR K E 99.6% 28.1 27.0 13.2 19.2 0 0 1 0 2 1,918.0103 4,576.58 12,504.2 292 308 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% IPIFSAAGLPHNEIAAQICR K Q 99.7% 64.3 27.2 13.4 63.4 0 0 2 0 2 2,178.1490 3,770.30 112557 189 208 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% SAIGEGMTR K K 99.7% 40.5 25.0 18.4 5.10 0 2 0 0 2 937.4409 904.392 41,546.7 404 412 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) V-type proton ATPase subunit B, brain isoform OS=Mus musculus OX=10090 GN=Atp6v1b2 PE=1 SV=1 P62814 Atp6v1b2 uniprot_Mus-musculus_SP.fasta 56,552.3 100.0% 6 6 8 0.0304% 18.6% TPVSEDMLGR R V 99.3% 34.2 25.0 13.5 26.3 0 1 0 0 2 1,120.5305 1,642.78 30,020.0 121 130 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Protein S100-A6 OS=Mus musculus OX=10090 GN=S100a6 PE=1 SV=3 P14069 S100a6 uniprot_Mus-musculus_SP.fasta 10,051.4 98.6% 1 1 2 0.00760% 19.1% ACPLDQAIGLLVAIFHK M Y 99.7% 66.5 25.0 13.5 54.3 0 2 0 0 1 1,908.0415 6,560.51 20,399.7 2 18 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Elongation factor 1-gamma OS=Mus musculus OX=10090 GN=Eef1g PE=1 SV=3 Q9D8N0 Eef1g uniprot_Mus-musculus_SP.fasta 50,061.3 98.6% 1 1 1 0.00380% 3.89% VTLADITVVCTLLWLYK R Q 97.8% 29.3 25.0 0.000 22.9 0 1 0 0 2 2,008.1190 6,028.78 980.200 157 173 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AGDTVGEGDLLVELE K - 99.7% 41.8 25.6 18.9 29.4 0 2 0 0 2 1,516.7380 4,183.02 84,767.0 710 724 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AKVNTIPGFDGVVK R D 99.2% 41.7 25.0 0.000 36.0 0 2 0 0 2 1,444.8160 2,804.84 84,376.1 183 196 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AKVNTIPGFDGVVKDADEAVR R I 99.7% 67.1 27.2 15.1 57.0 0 0 2 0 2 2,201.1563 3,285.24 210541 183 203 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AQAVHPGYGFLSENK R E 99.7% 51.2 26.8 14.6 50.4 0 0 2 0 2 1,617.8020 2,526.21 107776 132 146 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AQAVHPGYGFLSENKEFAK R R 99.7% 55.0 27.9 13.1 53.6 0 0 3 0 2 2,093.0451 2,781.07 107926 132 150 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% AQAVHPGYGFLSENKEFAKR R L 99.7% 42.8 28.2 0.000 42.1 0 0 3 0 2 2,249.1462 2,612.15 64,818.3 132 151 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% EAGGNMSIQFLGTVYK R V 99.7% 108 25.9 13.1 44.5 0 8 0 0 2 1,731.8260 3,805.43 191567 616 631 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% FLSDVYPDGFK K G 99.7% 78.6 25.0 21.0 68.4 0 2 0 0 2 1,287.6257 3,310.90 1444570 499 509 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% FLSDVYPDGFKGHTLTLSER K N 97.8% 22.0 27.8 14.3 12.4 0 0 1 0 2 2,282.1454 3,297.61 323587 499 518 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% FSSQEAASSFGDDR R L 99.7% 135 25.0 13.3 135 0 3 0 0 2 1,503.6346 2,251.75 420485 240 253 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% FSSQEAASSFGDDRLLIEK R F 99.7% 42.2 27.4 13.8 39.5 0 0 4 0 2 2,100.0245 3,187.50 4439090 240 258 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% FVKGDISTK R F 99.6% 36.7 25.0 17.3 32.2 0 2 0 0 2 994.5569 1,205.54 125558 490 498 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% GHTLTLSER K N 98.2% 32.4 25.0 0.000 32.4 0 2 0 0 2 1,013.5375 1,487.00 187430 510 518 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% GVTHNIPLLR R E 99.7% 40.2 25.0 13.2 8.78 0 2 0 0 2 1,119.6634 2,535.21 632604 473 482 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% HGNALWLNER K E 99.7% 47.8 25.0 13.8 47.7 0 2 0 0 2 1,209.6123 2,409.40 72,629.4 275 284 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% HIEIQVLGDK R H 99.7% 44.8 25.0 13.3 30.4 0 4 0 0 2 1,151.6421 2,541.87 262607 265 274 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% HKQEDIPISGWAVECR R V 99.7% 50.7 27.0 0.000 43.8 0 0 2 0 2 1,924.9336 2,807.22 381560 380 395 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% IAWDDEETRDGFR R F 99.7% 38.8 25.0 14.2 35.7 0 2 4 0 2 1,609.7243 2,677.40 2774470 227 239 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LAAEDVTFIGPDTHAIQAMGDKIESK R L 99.7% 45.5 28.5 14.3 45.5 0 0 4 0 2 2,773.3718 3,173.61 91,304.8 152 177 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LAAELNKFMLEK K V 99.7% 57.5 25.0 20.0 51.9 0 2 6 0 2 1,406.7713 2,885.35 677279 638 649 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LAAELNKFMLEKVPK K D 99.7% 37.6 25.0 0.000 34.6 0 0 5 0 2 1,730.9875 3,253.57 313382 638 652 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LHDEDHTVVASNNGPAFTVEVDGSK K L 99.7% 121 26.1 13.1 113 0 0 6 0 2 2,640.2062 2,775.96 122610 561 585 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LNVTSTWNLASPLLSVNVDGTQR K T 99.7% 40.2 27.0 13.3 39.8 0 0 2 0 2 2,485.3046 4,554.62 182544 586 608 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LQVEHPVTECITGLDLVQEMILVAK R G 99.7% 66.8 26.0 14.9 61.6 0 0 6 0 2 2,835.4999 5,160.04 80,015.0 350 374 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LSQYQEPIHLPGVR R V 99.7% 51.4 25.7 19.3 44.9 0 4 6 0 2 1,636.8807 3,051.85 5260470 413 426 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% LVTYGSDRAEALK K R 99.7% 61.4 25.2 20.6 51.9 0 2 0 0 2 1,422.7588 1,967.19 192039 448 460 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% MADEAVCVGPAPTSK K S 99.7% 106 25.0 14.0 99.4 0 4 0 0 2 1,548.7034 1,926.26 107115 101 115 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% MEDALDNYVIR R G 99.7% 76.4 25.0 17.0 66.1 0 6 0 0 2 1,354.6309 2,961.72 1206240 462 472 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% NFYFLEMNTR K L 99.7% 42.3 25.0 18.3 23.9 0 4 0 0 2 1,350.6147 3,640.86 533105 340 349 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% NQKVVEEAPSIFLDPETR R Q 97.5% 20.2 27.7 0.000 20.2 0 0 1 0 2 2,072.0660 3,321.04 105625 292 309 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% NQLLAIASSVFVASQLR R A 99.7% 108 25.0 20.6 108 0 10 31 0 2 1,817.0279 5,509.19 402392 519 535 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% QAMGEQAVALAK R A 99.7% 92.6 26.4 22.7 71.1 0 4 0 0 2 1,232.6305 1,919.49 844361 310 321 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% QEDIPISGWAVECR K V 99.7% 47.1 25.1 13.1 40.1 0 3 0 0 2 1,659.7797 3,390.38 54,074.1 382 395 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% RMEDALDNYVIR K G 99.7% 42.3 26.0 21.4 35.1 0 2 4 0 2 1,494.7370 2,665.11 267553 461 472 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% SFGLPSIGR K L 99.7% 47.2 25.3 21.8 43.8 0 2 0 0 2 933.5153 3,194.41 2137780 404 412 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% SYLNMDAIMEAIK K K 99.7% 74.6 25.0 17.7 71.6 0 4 0 0 2 1,498.7281 3,858.16 81,084.2 116 128 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% SYLNMDAIMEAIKK K T 99.7% 83.7 26.1 13.3 78.5 0 2 3 0 2 1,626.8231 4,216.07 206367 116 129 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% TVAIHSDVDASSVHVK K M 99.7% 73.9 27.3 14.4 73.4 0 2 3 0 2 1,664.8602 1,921.71 380486 85 100 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VNTIPGFDGVVK K D 98.8% 33.1 26.3 20.2 26.7 0 2 0 0 2 1,245.6839 3,128.66 218785 185 196 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VNTIPGFDGVVKDADEAVR K I 98.9% 22.3 27.5 14.9 15.8 0 0 2 0 2 2,002.0242 3,569.00 191910 185 203 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VPVIRPDVAK R W 99.7% 49.8 25.0 13.9 41.4 0 4 0 0 2 1,093.6729 1,936.42 267637 545 554 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VPVIRPDVAKWELSVK R L 99.7% 52.5 25.0 0.000 50.6 0 0 2 0 2 1,836.0743 3,313.84 1061880 545 560 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VVEEAPSIFLDPETR K Q 99.7% 94.3 27.3 18.1 93.6 0 4 1 0 2 1,701.8695 3,580.54 375930 295 309 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% VYAEDPYKSFGLPSIGR R L 99.7% 70.2 26.9 0.000 70.2 0 2 4 0 2 1,898.9648 3,532.39 1482200 396 412 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 45 73 213 0.810% 66.6% YSSAGTVEFLVDSQK K N 99.7% 112 25.8 15.0 106 0 10 2 0 2 1,630.7959 3,366.31 522842 325 339 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Synaptojanin-1 OS=Mus musculus OX=10090 GN=Synj1 PE=1 SV=3 Q8CHC4 Synj1 uniprot_Mus-musculus_SP.fasta 172,620.0 99.9% 1 1 2 0.00760% 0.762% VLDAYGLLGVLR K L 99.7% 47.8 25.0 13.2 45.9 0 2 0 0 2 1,288.7625 4,559.50 38,324.0 56 67 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.3% 1 1 1 0.00380% 7.42% FASFIDKVR K F 99.6% 39.4 25.0 0.000 0.000 0 1 0 0 2 1,082.5993 2,701.23 112052 142 150 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.3% 1 1 1 0.00380% 7.42% FLEQQNQVLQTK R W 99.7% 82.6 26.5 20.2 69.8 0 5 0 0 2 1,475.7854 2,414.25 215818 151 162 Empty false P04104,Q6IFZ6 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.3% 1 1 1 0.00380% 7.42% KLLEGEECR R M 99.7% 42.7 25.8 13.4 42.7 0 2 0 0 2 1,133.5621 1,313.69 83,972.0 435 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.3% 1 1 1 0.00380% 7.42% LLEGEECR K M 99.0% 53.4 25.0 26.3 41.6 0 2 0 0 2 1,005.4671 1,410.53 158728 436 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.3% 1 1 1 0.00380% 7.42% VRAQEREQIK K A 98.1% 21.6 26.1 31.1 4.92 0 0 1 0 2 1,257.6911 799.830 24,761.0 127 136 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2 P61982 Ywhag uniprot_Mus-musculus_SP.fasta 28,303.1 100.0% 4 4 7 0.0266% 15.4% AYSEAHEISK K E 99.7% 56.8 25.0 16.2 50.8 0 3 0 0 2 1,134.5425 1,087.30 45,345.7 153 162 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2 P61982 Ywhag uniprot_Mus-musculus_SP.fasta 28,303.1 100.0% 4 4 7 0.0266% 15.4% NLLSVAYK R N 97.7% 29.8 25.0 13.2 29.8 0 1 0 0 2 907.5247 2,777.22 68,456.2 43 50 Empty false P63101,P68254,P62259 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2 P61982 Ywhag uniprot_Mus-musculus_SP.fasta 28,303.1 100.0% 4 4 7 0.0266% 15.4% VDREQLVQK M A 96.3% 26.7 25.0 19.1 16.6 0 2 0 0 1 1,156.6322 1,922.13 113952 2 10 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2 P61982 Ywhag uniprot_Mus-musculus_SP.fasta 28,303.1 100.0% 4 4 7 0.0266% 15.4% YLAEVATGEK R R 99.5% 36.3 25.0 21.1 22.9 0 1 0 0 2 1,080.5572 1,901.33 40,105.6 133 142 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2 P61982 Ywhag uniprot_Mus-musculus_SP.fasta 28,303.1 100.0% 4 4 7 0.0266% 15.4% YLAEVATGEKR R A 99.7% 39.0 25.0 22.3 23.9 0 1 0 0 2 1,236.6583 1,662.80 40,455.5 133 143 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV=2 P39053 Dnm1 uniprot_Mus-musculus_SP.fasta 97,805.5 100.0% 2 2 4 0.0152% 3.46% ALLQMVQQFAVDFEK K R 99.0% 37.7 26.2 0.000 31.4 0 2 0 0 2 1,766.9147 5,468.39 7,150.40 328 342 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Dynamin-1 OS=Mus musculus OX=10090 GN=Dnm1 PE=1 SV=2 P39053 Dnm1 uniprot_Mus-musculus_SP.fasta 97,805.5 100.0% 2 2 4 0.0152% 3.46% SSVLENFVGRDFLPR K G 96.3% 20.1 26.6 21.9 15.0 0 0 2 0 2 1,735.9126 4,138.05 36,648.1 45 59 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus OX=10090 GN=Hnrnpk PE=1 SV=1 P61979 Hnrnpk uniprot_Mus-musculus_SP.fasta 50,978.5 98.6% 1 1 2 0.00760% 3.67% ILSISADIETIGEILKK R I 99.7% 40.8 25.0 15.0 26.3 0 0 2 0 2 1,843.0790 5,076.88 53,021.8 87 103 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus OX=10090 GN=Gnb2 PE=1 SV=3 P62880 Gnb2 uniprot_Mus-musculus_SP.fasta 37,331.8 99.8% 1 1 2 0.00760% 10.00% AGVLAGHDNR R V 99.7% 51.1 25.0 13.4 48.2 0 2 0 0 2 1,009.5174 930.106 73,341.8 305 314 Empty false P62874 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus OX=10090 GN=Gnb2 PE=1 SV=3 P62880 Gnb2 uniprot_Mus-musculus_SP.fasta 37,331.8 99.8% 1 1 2 0.00760% 10.00% LLVSASQDGK R L 96.0% 29.8 26.6 22.7 15.4 0 1 0 0 2 1,017.5576 1,599.92 60,898.7 69 78 Empty false P62874 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus OX=10090 GN=Gnb2 PE=1 SV=3 P62880 Gnb2 uniprot_Mus-musculus_SP.fasta 37,331.8 99.8% 1 1 2 0.00760% 10.00% SELEQLRQEAEQLR M N 99.7% 45.5 26.5 22.2 41.2 0 2 0 0 1 1,770.8982 3,994.71 54,739.8 2 15 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Potassium-transporting ATPase alpha chain 1 OS=Mus musculus OX=10090 GN=Atp4a PE=1 SV=3 Q64436 Atp4a uniprot_Mus-musculus_SP.fasta 114,018.7 98.9% 1 1 1 0.00380% 6.00% LIFDNLKK R S 98.4% 30.5 25.0 19.5 18.2 0 2 0 0 2 990.5984 2,549.48 128368 776 783 Empty false Q6PIC6,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Potassium-transporting ATPase alpha chain 1 OS=Mus musculus OX=10090 GN=Atp4a PE=1 SV=3 Q64436 Atp4a uniprot_Mus-musculus_SP.fasta 114,018.7 98.9% 1 1 1 0.00380% 6.00% NLEAVETLGSTSVICSDKTGTLTQNR K M 99.7% 45.7 28.7 13.6 7.59 0 0 1 0 2 2,796.3570 3,041.82 7,932.00 369 394 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Potassium-transporting ATPase alpha chain 1 OS=Mus musculus OX=10090 GN=Atp4a PE=1 SV=3 Q64436 Atp4a uniprot_Mus-musculus_SP.fasta 114,018.7 98.9% 1 1 1 0.00380% 6.00% VDNSSLTGESEPQTR K S 99.7% 97.7 25.1 16.8 86.1 0 2 0 0 2 1,619.7508 1,618.93 50,023.8 222 236 Empty false Q6PIC6,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Potassium-transporting ATPase alpha chain 1 OS=Mus musculus OX=10090 GN=Atp4a PE=1 SV=3 Q64436 Atp4a uniprot_Mus-musculus_SP.fasta 114,018.7 98.9% 1 1 1 0.00380% 6.00% VIMVTGDHPITAK R A 99.7% 47.8 25.0 13.3 44.9 0 2 2 0 2 1,397.7460 1,917.86 231759 622 634 Empty false Q6PIC6,Q6PIE5,Q8VDN2 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% AIHKIDIPSFDWPIAPFPR K L 99.6% 24.6 25.8 0.000 24.6 0 0 1 0 2 2,220.1967 4,403.39 28,158.6 232 250 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% GNYLVDVDGNR R M 99.7% 45.4 25.2 0.000 45.0 0 2 0 0 2 1,221.5859 2,469.49 85,043.4 82 92 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% IDIPSFDWPIAPFPR K L 99.7% 64.7 26.4 14.8 61.2 0 3 1 0 2 1,770.9216 4,970.37 58,164.9 236 250 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% LKYPLEEFTTDNQQEEAR R C 99.7% 60.3 27.0 0.000 57.5 0 0 4 0 2 2,211.0566 3,137.05 124221 251 268 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% MLDLYSQISSVPIGYNHPALAK R L 99.7% 58.2 27.8 13.4 57.2 0 0 3 0 2 2,417.2535 3,980.27 82,125.3 93 114 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% NLLLAEVINIIK K R 99.7% 63.0 25.0 24.0 60.2 0 2 0 0 2 1,352.8513 5,451.23 31,241.5 389 400 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% TLLTGLLDLQAQYPQFISR K V 99.7% 40.9 25.0 0.000 40.9 0 2 1 0 2 2,177.1968 5,037.13 13,369.7 414 432 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 8 12 24 0.0912% 25.2% TVAGIIVEPIQSEGGDNHASDDFFR R K 99.7% 41.0 27.8 13.2 38.5 0 0 5 0 2 2,674.2746 3,758.14 100643 286 310 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP-ribosylation factor 3 OS=Mus musculus OX=10090 GN=Arf3 PE=2 SV=2 P61205,P84078 Arf1,Arf3 uniprot_Mus-musculus_SP.fasta 20,601.7 99.9% 2 2 3 0.0114% 15.5% MLAEDELRDAVLLVFANK R Q 97.4% 33.0 26.9 13.7 29.4 0 0 2 0 2 2,047.0894 5,310.52 26,095.6 110 127 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) ADP-ribosylation factor 3 OS=Mus musculus OX=10090 GN=Arf3 PE=2 SV=2 P61205,P84078 Arf1,Arf3 uniprot_Mus-musculus_SP.fasta 20,601.7 99.9% 2 2 3 0.0114% 15.5% VNEAREELMR R M 96.3% 17.6 25.8 15.6 13.5 0 0 1 0 2 1,262.6158 1,269.63 50,888.7 100 109 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Protein NipSnap homolog 1 OS=Mus musculus OX=10090 GN=Nipsnap1 PE=1 SV=1 O55125 Nipsnap1 uniprot_Mus-musculus_SP.fasta 33,364.3 98.6% 1 1 2 0.00760% 3.17% AGPNIYELR R T 99.7% 48.2 26.1 22.0 39.8 0 2 0 0 2 1,032.5473 2,662.40 133355 180 188 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Etfa PE=1 SV=2 Q99LC5 Etfa uniprot_Mus-musculus_SP.fasta 35,009.8 99.9% 1 1 2 0.00760% 3.90% LNVAPVSDIIEIK K S 99.2% 34.0 25.0 0.000 34.0 0 2 0 0 2 1,410.8204 3,803.15 73,046.5 127 139 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Mus musculus OX=10090 GN=Ndufa10 PE=1 SV=1 Q99LC3 Ndufa10 uniprot_Mus-musculus_SP.fasta 40,604.7 100.0% 2 2 4 0.0152% 9.30% LLQYADALEHLLSTGQGVVLER R S 99.7% 33.6 25.8 0.000 33.6 0 0 2 0 2 2,425.3088 4,994.06 21,977.4 140 161 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Mus musculus OX=10090 GN=Ndufa10 PE=1 SV=1 Q99LC3 Ndufa10 uniprot_Mus-musculus_SP.fasta 40,604.7 100.0% 2 2 4 0.0152% 9.30% YGLLAAILGDK R T 99.7% 64.9 25.0 13.2 60.5 0 2 0 0 2 1,133.6567 4,627.75 38,525.6 38 48 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 5 5 8 0.0304% 15.8% APIQWEER K N 99.0% 70.8 25.0 13.2 63.1 0 2 0 0 2 1,028.5160 2,267.96 218032 59 66 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 5 5 8 0.0304% 15.8% DMANPTALLLSAVMMLR K H 98.6% 25.5 27.5 13.0 22.3 0 0 1 0 2 1,862.9539 6,120.18 4,034.40 300 316 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 5 5 8 0.0304% 15.8% IAEFAFEYAR R N 99.7% 62.8 25.0 24.7 53.8 0 2 0 0 2 1,216.5996 3,363.11 174688 179 188 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 5 5 8 0.0304% 15.8% NVTAIQGPGGK R W 99.0% 32.6 25.0 13.2 24.2 0 2 0 0 2 1,041.5689 1,473.85 124175 67 77 Empty true 22-2895 19 19 20220411_bbm1840_22-2895_Killinger_9 (F006909) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 5 5 8 0.0304% 15.8% TPYTDVNIVTIR K E 99.7% 56.1 25.9 16.1 56.1 0 1 0 0 2 1,391.7530 3,153.33 46,269.8 135 146 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% AILVDLEPGTMDSVR R S 98.3% 49.7 27.1 17.7 47.2 0 2 0 0 2 1,631.8312 3,266.73 31,214.6 63 77 Empty true P99024,Q9ERD7 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% GHYTEGAELVDSVLDVVRK K E 99.7% 46.9 27.7 15.9 39.9 0 0 2 0 2 2,087.0769 4,279.00 57,288.7 104 122 Empty true P99024,Q9ERD7,Q922F4,P68372 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% LAVNMVPFPR K L 99.7% 69.6 26.8 17.9 65.9 0 2 0 0 2 1,159.6293 3,029.66 64,959.8 253 262 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% MSMKEVDEQMLNVQNK R N 99.7% 38.8 25.0 0.000 37.4 0 0 2 0 2 1,971.8822 1,667.19 23,266.2 321 336 Empty true P99024,P68372 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 50.0 28.0 14.2 4.89 0 0 4 0 2 2,798.3435 4,368.72 44,560.4 78 103 Empty true P99024,Q9D6F9,P68372 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 6 7 13 0.0511% 21.3% YLTVAAIFR R G 99.4% 40.0 25.0 0.000 38.5 0 1 0 0 2 1,053.6091 3,967.81 24,494.7 310 318 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 99.1% 1 1 1 0.00393% 3.66% ALMLQGVDLLADAVAVTMGPK R G 99.7% 35.9 25.8 14.3 26.1 0 0 1 0 2 2,113.1399 5,978.24 3,268.70 38 58 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 99.8% 1 1 2 0.00786% 1.99% TTLTAAITK K I 98.5% 36.0 25.0 14.4 36.0 0 2 0 0 2 919.5460 2,241.65 68,768.2 71 79 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% AKDINQEVYNFLATAGAK R Y 99.7% 50.1 27.2 16.2 44.3 0 0 2 0 2 1,953.0077 4,108.84 38,413.8 143 160 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% ATIERDGYAQILR R D 99.7% 33.4 25.9 19.1 30.5 0 0 1 0 2 1,505.8072 2,626.21 29,128.1 425 437 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% DINQEVYNFLATAGAK K Y 99.7% 45.6 26.5 14.9 37.3 0 0 2 0 2 1,753.8756 4,764.71 15,825.5 145 160 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% FKLEAPDADELPR K S 99.7% 39.0 26.0 18.1 32.8 0 0 2 0 2 1,500.7695 3,042.55 71,433.5 522 534 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% IVYGHLDDPANQEIER K G 99.7% 43.1 26.5 13.1 42.0 0 0 1 0 2 1,868.9139 2,523.26 66,373.3 69 84 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% NAVTQEFGPVPDTAR R Y 99.7% 82.5 25.9 15.7 71.9 0 2 0 0 2 1,601.7919 2,767.61 19,239.8 634 648 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% SQFTITPGSEQIR K A 99.5% 42.4 26.7 16.4 38.6 0 1 0 0 2 1,463.7490 2,697.14 21,572.4 412 424 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% VAMSHFEPSEYIR K Y 99.7% 34.8 25.0 16.1 31.7 0 0 2 0 2 1,581.7366 2,635.86 66,823.6 32 44 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 9 9 15 0.0590% 14.9% WVVIGDENYGEGSSR R E 99.7% 77.6 25.0 13.2 76.5 0 2 0 0 2 1,667.7660 3,070.65 14,434.9 657 671 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1 Q9D0K2 Oxct1 uniprot_Mus-musculus_SP.fasta 55,990.2 99.1% 1 1 1 0.00393% 2.12% DGSVAIASKPR K E 99.7% 52.5 25.6 31.5 45.4 0 1 0 0 2 1,100.6059 1,215.04 13,870.9 177 187 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 99.8% 1 1 2 0.00786% 1.66% NTVIATGGYGR K T 99.7% 54.0 25.0 17.8 51.3 0 2 0 0 2 1,108.5746 1,892.82 31,527.5 251 261 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 1 1 2 0.00786% 2.47% AAQEEYIKR K A 99.7% 55.6 25.3 0.000 54.7 0 2 0 0 2 1,107.5793 1,276.24 21,416.3 323 331 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% ALEESNYELEGK R I 99.7% 102 25.0 24.1 93.4 0 2 0 0 2 1,381.6482 2,181.25 414950 164 175 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% LENEIQTYR R S 99.7% 47.8 25.4 21.0 39.8 0 2 0 0 2 1,165.5848 2,008.60 116741 440 448 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% QSLEASLAETEGR K Y 99.7% 93.5 25.9 21.1 81.0 0 2 0 0 2 1,390.6809 2,701.23 129586 385 397 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% QSVEADINGLR R R 99.7% 63.4 25.0 16.2 62.9 0 2 0 0 2 1,201.6172 2,649.67 51,195.3 244 254 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% QSVEADINGLRR R V 99.7% 29.9 25.7 17.9 26.5 0 0 6 0 2 1,357.7183 2,477.16 343488 244 255 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 5 6 14 0.0550% 9.65% VTMQNLNDR R L 99.7% 79.7 25.0 25.5 0.000 0 2 0 0 2 1,106.5260 1,037.07 111764 146 154 Empty false Q9Z2K1,Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 2 2 3 0.0118% 7.34% IGAGDYQPTEQDILR R T 99.5% 50.4 27.1 13.6 43.3 0 1 0 0 2 1,675.8289 2,959.63 11,204.1 163 177 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 2 2 3 0.0118% 7.34% LLLLGAGESGK K S 99.7% 42.8 25.0 0.000 0.000 0 2 0 0 2 1,057.6254 2,927.38 64,587.1 36 46 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 3 4 0.0157% 10.8% FCTGLTQIETLFK R S 99.7% 69.7 26.3 13.0 69.7 0 2 0 0 2 1,557.7984 4,541.53 27,142.4 253 265 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 3 4 0.0157% 10.8% LGFSEVELVQMVVDGVK R L 98.1% 46.5 26.6 13.3 43.0 0 1 0 0 2 1,848.9777 5,332.89 1,840.60 342 358 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 3 4 0.0157% 10.8% VLTPELYAELR K A 98.9% 39.8 25.0 15.7 28.6 0 1 0 0 2 1,303.7257 3,495.59 24,691.1 33 43 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 99.1% 1 2 3 0.0118% 9.64% ITVVGVGAVGMACAISILMK K D 99.7% 77.4 25.0 0.000 72.9 0 1 2 0 2 1,990.0900 5,753.50 35,913.0 23 42 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 99.1% 1 2 3 0.0118% 9.64% VIGSGCNLDSAR R F 99.7% 53.6 25.0 13.0 53.6 0 1 0 0 2 1,248.6002 1,780.90 12,914.4 158 169 Empty false P16125 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 98.9% 1 1 2 0.00786% 2.73% IAEFAFEYAR R N 99.7% 45.8 25.0 13.7 41.6 0 2 0 0 2 1,216.5996 3,400.96 54,885.3 179 188 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 85.8% 1 1 1 0.00393% 3.34% IAVAAQNCYK K V 95.2% 36.3 25.0 13.2 36.3 0 1 0 0 2 1,137.5721 1,695.60 14,884.2 110 119 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 173 181 Empty true Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% KLLEGEECR R L 99.7% 47.3 25.8 16.9 47.0 0 1 0 0 2 1,133.5621 1,360.47 22,495.8 466 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% LLEGEECR K L 99.0% 49.0 25.0 24.4 37.3 0 2 0 0 2 1,005.4671 1,447.67 73,122.6 467 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% LRSEIDNVK R K 97.4% 35.8 26.0 23.6 26.7 0 1 0 0 2 1,073.5950 1,413.66 18,733.2 390 398 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% LRSEIDNVKK R Q 99.7% 40.7 25.0 29.9 13.6 0 2 2 0 2 1,201.6900 1,174.76 219173 390 399 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% NKYEDEINKR K T 99.7% 48.0 25.3 16.0 37.5 0 2 5 0 2 1,308.6543 1,435.62 251717 250 259 Empty true Q8VED5,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% SLDLDSIIAEVK R A 99.7% 100 25.8 27.2 86.6 0 4 0 0 2 1,302.7153 4,395.16 138118 326 337 Empty true P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 168 179 Empty true Q3TTY5,Q8VED5,Q3UV17,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 168 181 Empty true Q3TTY5,Q8VED5,Q3UV17,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% VDALMDEINFMK R M 97.4% 30.1 25.0 0.000 30.1 0 1 0 0 2 1,457.6653 3,056.21 13,621.2 287 298 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 11 14 26 0.102% 13.3% YEELQQTAGR K H 99.7% 52.5 25.0 23.8 48.8 0 2 0 0 2 1,194.5750 1,579.11 38,736.0 359 368 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 100.0% 1 2 4 0.0157% 6.78% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 150 158 Empty false Q3TTY5,P04104,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 100.0% 1 2 4 0.0157% 6.78% NKYEDEINKR K T 99.7% 48.0 25.3 16.0 37.5 0 2 5 0 2 1,308.6543 1,435.62 251717 228 237 Empty false Q922U2,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 100.0% 1 2 4 0.0157% 6.78% NLDLDSIIAEVK R A 99.7% 85.1 25.8 32.0 62.4 0 4 0 0 2 1,329.7262 4,636.77 210536 304 315 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 100.0% 1 2 4 0.0157% 6.78% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 145 156 Empty false Q3TTY5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 100.0% 1 2 4 0.0157% 6.78% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 145 158 Empty false Q3TTY5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 3 0.0118% 9.52% NMITGTSQADCAVLIVAAGVGEFEAGISK K N 99.6% 36.5 28.5 17.4 30.2 0 0 1 0 2 2,909.4386 5,705.19 1,195.20 101 129 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 3 0.0118% 9.52% THINIVVIGHVDSGK K S 99.7% 61.1 25.4 13.3 55.0 0 0 2 0 2 1,588.8807 2,526.19 82,807.6 6 20 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 28 OS=Mus musculus OX=10090 GN=Krt28 PE=1 SV=1 A6BLY7 Krt28 uniprot_Mus-musculus_SP.fasta 50,346.9 99.1% 1 1 4 0.0157% 1.95% VTMQNLNNR K L 99.7% 83.0 25.0 27.7 0.000 0 4 0 0 2 1,106.5259 1,036.55 248753 86 94 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% ARLECEINTYR R S 98.8% 38.8 25.6 13.0 37.3 0 1 0 0 2 1,424.6951 2,195.27 26,569.0 347 357 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% ILDELTLCK R S 99.7% 58.6 26.1 20.2 47.1 0 2 0 0 2 1,104.5972 2,995.46 57,401.4 165 173 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% LECEINTYR R S 99.7% 51.0 25.0 14.1 46.5 0 2 0 0 2 1,197.5569 2,034.45 66,726.5 349 357 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% LNVEVDAAPTVDLNR R V 99.7% 57.7 26.0 13.2 53.9 0 2 0 0 2 1,625.8494 3,064.45 22,609.0 209 223 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% LVVQIDNAK R L 99.7% 50.1 25.0 21.3 33.2 0 1 0 0 2 999.5834 2,114.65 40,871.9 127 135 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% NHEEEVNTLR K C 96.2% 32.2 25.0 17.8 28.1 0 2 0 0 2 1,240.5916 1,310.40 26,550.6 193 202 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% NSLENTLTESEAR R Y 99.7% 73.4 25.4 15.3 15.9 0 2 0 0 2 1,464.6813 2,679.64 59,498.8 294 306 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% QNQEYQVLLDVR R A 99.4% 48.8 26.9 17.0 45.9 0 1 0 0 2 1,504.7755 3,376.19 44,652.3 335 346 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cuticular Ha4 OS=Mus musculus OX=10090 GN=Krt34 PE=2 SV=1 Q9D646 Krt34 uniprot_Mus-musculus_SP.fasta 44,559.2 100.0% 9 9 14 0.0550% 22.2% TIEELQQK R I 96.9% 36.4 25.2 25.9 24.6 0 1 0 0 2 988.5311 1,550.21 30,386.4 109 116 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 1 1 2 0.00786% 18.0% GHYTEGAELVDSVLDVVRK K E 99.7% 46.9 27.7 15.9 39.9 0 0 2 0 2 2,087.0769 4,279.00 57,288.7 104 122 Empty false P99024,Q9ERD7,Q922F4,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 1 1 2 0.00786% 18.0% LAVNMVPFPR K L 99.7% 69.6 26.8 17.9 65.9 0 2 0 0 2 1,159.6293 3,029.66 64,959.8 253 262 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 1 1 2 0.00786% 18.0% MSMKEVDEQMLNVQNK R N 99.7% 38.8 25.0 0.000 37.4 0 0 2 0 2 1,971.8822 1,667.19 23,266.2 321 336 Empty false P99024,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 1 1 2 0.00786% 18.0% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 50.0 28.0 14.2 4.89 0 0 4 0 2 2,798.3435 4,368.72 44,560.4 78 103 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 1 1 2 0.00786% 18.0% YLTVAAVFR R G 99.7% 45.8 25.0 0.000 45.8 0 2 0 0 2 1,039.5934 3,603.80 75,041.4 310 318 Empty true P99024,Q9D6F9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 99.1% 1 1 1 0.00393% 3.68% DLVILLYETALLSSGFSLEDPQTHANR K I 99.7% 67.9 27.6 16.8 62.3 0 0 1 0 2 3,002.5472 5,994.88 1,324.00 662 688 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% AVFVDLEPTVIDEVR R T 99.7% 62.5 26.4 17.3 35.5 0 2 0 0 2 1,701.9059 4,098.18 67,186.0 65 79 Empty false P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% DVNAAIATIK K T 99.7% 44.6 26.8 22.1 39.3 0 2 0 0 2 1,015.5783 2,534.13 75,169.1 327 336 Empty false P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% EIIDLVLDR K I 99.5% 41.4 25.0 15.3 37.9 0 2 0 0 2 1,085.6203 3,805.50 40,030.6 113 121 Empty false P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% GHYTIGKEIIDLVLDR R I 99.7% 71.3 25.6 13.2 63.2 0 0 4 0 2 1,842.0123 4,703.78 39,287.0 106 121 Empty false P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% LIGQIVSSITASLR R F 99.7% 77.3 25.0 0.000 77.3 0 3 0 0 2 1,457.8687 4,797.14 25,080.6 230 243 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% NLDIERPTYTNLNR R L 99.7% 33.5 27.8 19.5 26.8 0 0 2 0 2 1,718.8821 2,609.73 79,344.3 216 229 Empty false P68368,P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 99.1% 1 1 3 0.0118% 19.3% VGINYQPPTVVPGGDLAK K V 97.9% 35.7 25.0 13.0 33.6 0 2 0 0 2 1,824.9857 3,237.44 57,204.1 353 370 Empty false P68368,P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 24 OS=Mus musculus OX=10090 GN=Krt24 PE=2 SV=2 A1L317 Krt24 uniprot_Mus-musculus_SP.fasta 54,041.3 99.7% 1 1 1 0.00393% 1.76% LANYLDKVR R A 97.2% 34.1 25.0 13.6 25.8 0 1 0 0 2 1,092.6049 3,627.84 31,665.3 152 160 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3 Q61171 Prdx2 uniprot_Mus-musculus_SP.fasta 21,779.1 94.7% 1 1 2 0.00786% 5.56% QITVNDLPVGR R S 98.3% 37.2 25.0 13.2 30.2 0 2 0 0 2 1,211.6744 2,826.05 35,557.1 140 150 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 99.1% 1 1 1 0.00393% 3.59% VIGSGCNLDSAR R F 99.7% 53.6 25.0 13.0 53.6 0 1 0 0 2 1,248.6002 1,780.90 12,914.4 159 170 Empty true P06151 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% AIGIGAYLVR R L 99.7% 61.0 25.0 18.0 0.000 0 2 0 0 2 1,032.6201 3,473.36 77,211.1 1823 1832 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% ATLVEHGIR K R 97.7% 32.3 25.0 14.1 26.3 0 1 0 0 2 995.5633 1,562.74 23,927.2 1316 1324 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% AVVMDLLR K Q 99.0% 40.6 25.0 24.9 22.0 0 2 0 0 2 932.5235 2,769.60 42,954.0 984 991 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% DKFEEDRIYR R H 99.2% 29.4 25.3 15.2 21.9 0 0 1 0 2 1,370.6700 1,877.61 44,680.9 1361 1370 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% EGLPLMVFANWR R G 99.7% 48.5 27.3 13.4 41.2 0 2 0 0 2 1,432.7406 4,917.29 14,584.6 2035 2046 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% EVFFMNTQSIVQLVQR R Y 99.5% 30.1 27.1 17.1 25.5 0 0 1 0 2 1,955.0056 4,211.57 14,471.0 958 973 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% FVVMVTPEDLK R A 99.7% 55.8 26.1 17.2 53.5 0 4 0 0 2 1,293.6761 3,230.06 98,978.3 152 162 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% GQVLPAHTLLNTVDVELIYEGIK R Y 99.4% 28.8 25.0 0.000 28.8 0 0 2 0 2 2,522.3868 4,706.27 41,750.4 657 679 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% GVINDILDWK K T 99.7% 61.0 26.2 23.6 47.9 0 2 0 0 2 1,172.6312 4,375.68 27,206.5 2199 2208 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% HLEPALAFQLELNR R M 99.7% 52.2 25.1 21.9 31.0 0 0 2 0 2 1,650.8963 3,725.52 79,958.9 1371 1384 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% HLEVQILADQYGNAISLFGR R D 99.5% 32.1 27.1 0.000 32.1 0 0 1 0 2 2,244.1773 4,578.84 9,781.00 356 375 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IDTGWLDR R L 99.0% 54.7 26.5 28.6 22.7 0 2 0 0 2 975.4896 2,915.59 107941 607 614 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IDTGWLDRLIAEK R V 99.7% 34.7 25.8 20.1 26.6 0 0 2 0 2 1,529.8325 4,264.21 46,708.6 607 619 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IGLAEEIR R H 99.0% 53.9 25.1 32.9 35.8 0 2 0 0 2 900.5150 2,503.58 92,443.8 1723 1730 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IIEFVPTK R A 95.9% 30.4 25.0 15.4 23.8 0 1 0 0 2 946.5609 2,784.39 27,410.8 1921 1928 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IIQQAGQVWFPDSAFK K T 99.7% 63.9 27.0 0.000 57.4 0 2 0 0 2 1,834.9488 3,892.20 29,503.4 2009 2024 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% ITDIIGKEEGLGAENLR K G 99.7% 51.4 26.1 24.2 42.7 0 0 2 0 2 1,827.9814 2,974.00 47,179.7 1781 1797 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% ITSENPDEGFKPSSGTVQELNFR R S 99.7% 58.3 27.4 15.1 56.6 0 0 2 0 2 2,552.2265 3,061.14 35,160.9 509 531 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% IYVAANSGAR R I 98.8% 36.4 25.1 24.7 33.2 0 2 0 0 2 1,022.5265 1,496.41 45,409.3 1713 1722 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% LGGIPVGVVAVETR R T 99.7% 44.2 25.0 14.4 32.7 0 1 0 0 2 1,366.8054 3,335.90 65,055.6 1977 1990 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% LILSETSIFDVLPNFFYHSNQVVR K M 99.7% 52.2 26.4 0.000 52.2 0 0 2 0 2 2,838.4825 5,524.59 10,230.1 1122 1145 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% LLETESFQLNR K I 99.7% 64.4 26.0 19.4 50.4 0 2 0 0 2 1,349.7060 2,991.93 95,378.4 596 606 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% LTFLVAQK R D 98.6% 33.4 25.0 19.2 19.8 0 2 0 0 2 919.5612 2,888.18 60,504.9 1326 1333 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% MAALEVYVR R R 99.4% 42.0 25.0 15.2 24.0 0 1 0 0 2 1,067.5554 2,596.82 35,619.4 1146 1154 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% NSISNFLHSLER R G 99.7% 46.4 26.3 27.4 35.8 0 0 2 0 2 1,416.7229 4,049.75 90,389.8 645 656 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% QGPLHGMLINTPYVTK K D 97.5% 22.5 26.4 13.1 9.79 0 0 2 0 2 1,784.9367 2,753.06 79,167.2 1564 1579 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% QVLIASHLPSYELR R H 99.7% 65.1 25.0 13.1 54.8 0 2 1 0 2 1,625.9010 3,223.17 51,214.1 1082 1095 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% QVNCEVDQR K F 99.7% 56.8 25.0 0.000 55.3 0 2 0 0 2 1,147.5161 1,030.85 18,589.2 1338 1346 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% RAYIAYELNSVQHR R Q 99.7% 60.5 26.8 13.4 52.2 0 0 2 0 2 1,719.8924 2,533.35 85,216.7 1155 1168 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% SVHSSVPLLNSKDPIDR K I 99.7% 36.7 26.3 0.000 36.0 0 0 2 0 2 1,863.9924 2,561.60 126631 1904 1920 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% TAQIMFQAYGDK R Q 99.7% 46.0 25.0 13.1 45.3 0 2 0 0 2 1,388.6517 2,540.43 39,613.3 1552 1563 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% TCVFEKENDPSVMR K S 99.7% 34.3 25.0 16.7 32.3 0 0 1 0 2 1,727.7728 1,908.39 34,471.1 741 754 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% TIQVENSHLILTGAGALNK R V 99.7% 36.5 25.0 16.6 2.75 0 0 1 0 2 1,979.0922 3,163.50 41,026.4 1837 1855 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% TLRDPSLPLLELQDIMTSVSGR K I 99.7% 48.9 25.8 13.2 48.9 0 0 2 0 2 2,441.3072 5,268.86 11,300.8 887 908 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VDWQENDFSKR R I 96.7% 22.1 25.0 14.8 11.9 0 0 1 0 2 1,423.6601 2,345.08 36,074.4 266 276 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VETQFQNGHYDK R C 97.7% 22.4 25.0 18.9 2.21 0 0 1 0 2 1,466.6548 1,677.13 26,514.3 996 1007 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VEVGTEVTDYR K F 99.7% 69.6 25.0 17.0 65.6 0 2 0 0 2 1,267.6165 2,304.56 49,202.5 1409 1419 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VLIANNGIAAVK K C 99.7% 56.8 25.0 17.3 12.6 0 2 0 0 2 1,183.7046 2,728.94 62,771.9 120 131 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VNNADDFPNLFR K Q 99.7% 48.2 25.7 13.4 47.3 0 2 0 0 2 1,421.6808 3,652.34 38,368.9 323 334 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VQQAELHTGSLPQIQSTALR K G 99.7% 71.1 26.2 13.7 70.0 0 0 2 0 2 2,177.1675 2,944.90 60,700.8 825 844 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VQQAELHTGSLPQIQSTALRGEK K L 99.7% 45.7 26.0 15.3 34.7 0 0 3 0 2 2,491.3266 2,752.18 26,134.4 825 847 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% VSALNSVHCEHVEDEGESR R Y 94.9% 20.5 25.0 13.1 20.5 0 0 1 0 2 2,153.9516 1,826.58 9,599.40 1760 1778 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 43 44 78 0.307% 24.1% YLYLTPQDYKR K V 98.2% 27.7 26.6 19.2 24.8 0 0 2 0 2 1,459.7581 2,742.08 112597 1749 1759 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 2 3 7 0.0275% 5.73% IIAEGANGPTTPEADKIFLER K N 99.7% 52.7 27.6 17.6 41.1 0 0 4 0 2 2,242.1717 3,228.11 84,096.5 400 420 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 2 3 7 0.0275% 5.73% YSTDVSVDEVK R A 99.7% 52.8 25.0 13.5 46.0 0 3 0 0 2 1,241.5896 2,152.79 56,248.6 152 162 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% ALEHFTDLYDIKR R A 99.7% 51.2 26.4 0.000 49.3 0 0 2 0 2 1,620.8382 2,996.58 48,194.9 626 638 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% KFNALFAQGNYSEAAK R V 95.0% 22.5 26.9 15.9 22.5 0 0 1 0 2 1,758.8809 2,831.43 25,236.7 367 382 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% KVGYTPDWIFLLR K N 98.0% 23.0 25.0 14.6 19.6 0 0 1 0 2 1,607.8946 4,516.51 8,391.50 507 519 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% LHIIEVGTPPTGNQPFPK K K 99.1% 25.1 25.4 13.3 22.3 0 0 1 0 2 1,945.0545 3,173.36 28,487.6 228 245 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% LLYNNVSNFGR K L 99.7% 52.6 25.7 0.000 52.6 0 1 0 0 2 1,296.6694 2,936.85 20,596.4 1216 1226 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 8 0.0315% 4.96% NLQNLLILTAIK R A 99.5% 44.7 25.0 13.3 40.2 0 2 0 0 2 1,353.8466 4,557.38 24,833.1 1023 1034 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 86.9% 1 1 1 0.00393% 3.36% IQTQPGYANTLR R E 95.6% 31.3 26.8 16.5 16.4 0 1 0 0 2 1,361.7173 2,072.54 31,477.3 185 196 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Mus musculus OX=10090 GN=Hmgcs2 PE=1 SV=2 P54869 Hmgcs2 uniprot_Mus-musculus_SP.fasta 56,824.3 97.6% 1 1 2 0.00786% 1.97% APLVLEQGLR K G 99.3% 42.3 25.0 0.000 40.5 0 2 0 0 2 1,095.6522 2,909.52 49,810.0 222 231 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 99.8% 1 1 1 0.00393% 4.19% TATFAISILQQIELDLK K A 99.7% 52.3 25.0 13.6 52.3 0 1 0 0 2 1,904.0742 5,802.33 1,312.20 83 99 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 99.5% 1 2 2 0.00786% 5.29% SELDQLRQEAEQLKNQIR M D 98.2% 31.3 27.7 14.2 2.46 0 0 2 0 1 2,241.1472 4,249.08 39,294.9 2 19 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00786% 12.5% DVNAAIAAIK K T 99.7% 46.8 25.0 13.5 38.6 0 2 0 0 2 985.5677 2,772.00 46,739.4 327 336 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00786% 12.5% LISQIVSSITASLR R F 99.7% 70.9 25.0 0.000 69.1 0 2 1 0 2 1,487.8792 4,960.50 19,233.2 230 243 Empty false P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00786% 12.5% NLDIERPTYTNLNR R L 99.7% 33.5 27.8 19.5 26.8 0 0 2 0 2 1,718.8821 2,609.73 79,344.3 216 229 Empty false P68369,P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00786% 12.5% VGINYQPPTVVPGGDLAK K V 97.9% 35.7 25.0 13.0 33.6 0 2 0 0 2 1,824.9857 3,237.44 57,204.1 353 370 Empty false P68369,P05213 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% AVFVDLEPTVIDEVR R T 99.7% 62.5 26.4 17.3 35.5 0 2 0 0 2 1,701.9059 4,098.18 67,186.0 65 79 Empty true P68369 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% DVNAAIATIK K T 99.7% 44.6 26.8 22.1 39.3 0 2 0 0 2 1,015.5783 2,534.13 75,169.1 327 336 Empty true P68369 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% EIIDLVLDR K I 99.5% 41.4 25.0 15.3 37.9 0 2 0 0 2 1,085.6203 3,805.50 40,030.6 113 121 Empty true P68369 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% GHYTIGKEIIDLVLDR R I 99.7% 71.3 25.6 13.2 63.2 0 0 4 0 2 1,842.0123 4,703.78 39,287.0 106 121 Empty true P68369 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% LISQIVSSITASLR R F 99.7% 70.9 25.0 0.000 69.1 0 2 1 0 2 1,487.8792 4,960.50 19,233.2 230 243 Empty true P68368 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% NLDIERPTYTNLNR R L 99.7% 33.5 27.8 19.5 26.8 0 0 2 0 2 1,718.8821 2,609.73 79,344.3 216 229 Empty true P68369,P68368 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 7 8 17 0.0668% 19.3% VGINYQPPTVVPGGDLAK K V 97.9% 35.7 25.0 13.0 33.6 0 2 0 0 2 1,824.9857 3,237.44 57,204.1 353 370 Empty true P68369,P68368 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 9 0.0354% 14.4% ASAELALGENNEVLK K S 98.1% 35.8 26.2 21.3 28.1 0 2 0 0 2 1,557.8119 2,875.27 19,023.0 108 122 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 9 0.0354% 14.4% FVTVQTISGTGALR R V 99.7% 57.9 25.0 15.6 57.9 0 2 0 0 2 1,449.8061 3,091.82 48,802.3 126 139 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 9 0.0354% 14.4% ILIRPLYSNPPLNGAR K I 98.3% 25.1 25.0 13.1 7.08 0 0 1 0 2 1,795.0227 3,190.61 29,855.4 310 325 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 9 0.0354% 14.4% VGAFTVVCK R D 99.7% 60.1 25.0 16.7 56.1 0 2 0 0 2 980.5234 2,365.57 57,221.5 288 296 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 9 0.0354% 14.4% VGASFLQR R F 99.0% 48.3 25.0 29.5 31.5 0 2 0 0 2 877.4890 2,334.83 63,340.8 140 147 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 99.4% 1 1 1 0.00393% 2.51% ITQYLDAGGIPR R T 99.7% 53.8 25.7 15.5 49.6 0 1 0 0 2 1,303.7007 2,819.42 20,522.6 434 445 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 4 4 7 0.0275% 12.7% ANTFVAELK R G 99.7% 48.5 25.0 0.000 38.7 0 1 0 0 2 992.5411 2,655.33 27,136.0 177 185 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 4 4 7 0.0275% 12.7% GCDVVVIPAGVPR K K 99.7% 58.8 25.0 18.4 50.9 0 2 0 0 2 1,338.7200 3,066.74 53,445.1 92 104 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 4 4 7 0.0275% 12.7% IFGVTTLDIVR K A 98.3% 35.2 25.0 16.0 29.2 0 3 0 0 2 1,233.7203 3,973.75 52,064.8 166 176 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 4 4 7 0.0275% 12.7% IQEAGTEVVK R A 98.0% 37.8 26.7 30.3 11.2 0 1 0 0 2 1,073.5838 1,504.56 23,904.2 230 239 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 1 1 2 0.00786% 2.82% SVINLLFAAYTGDVSALRR K F 99.7% 32.1 25.0 14.2 23.7 0 0 2 0 2 2,066.1393 5,173.82 18,626.9 558 576 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ACTELGIR R T 99.0% 38.9 26.1 25.4 25.2 0 2 0 0 2 919.4667 1,881.57 81,450.3 55 62 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ADFAQACQDAGVR R F 99.7% 77.4 25.0 13.5 68.7 0 2 0 0 2 1,408.6275 2,130.07 50,634.5 125 137 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% AEAEAQAEELSFPR R S 99.7% 105 25.3 15.1 92.5 0 4 2 0 2 1,547.7336 2,845.02 303277 929 942 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% AGTHILCIK R D 98.8% 39.4 25.0 14.3 34.8 0 2 0 0 2 1,012.5610 2,038.54 87,861.9 733 741 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ALAVSDLNR K A 99.7% 48.5 25.0 16.0 25.2 0 7 0 0 2 958.5316 2,153.61 1008940 1062 1070 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% AYSEALAAFGNGALFVEK R F 99.7% 83.2 27.1 18.1 73.7 0 9 2 0 2 1,857.9381 4,251.34 116592 220 237 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% AYVEANQMLGDLIK K V 99.7% 92.8 26.6 20.6 83.8 0 2 0 0 2 1,580.7991 3,238.13 27,086.8 893 906 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% DFTATFGPLDSLNTR K L 99.7% 72.9 26.3 14.0 66.1 0 2 0 0 2 1,654.8073 3,959.28 60,324.3 1022 1036 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% DVKGQIGAPMPGK K V 98.9% 32.7 25.0 0.000 32.7 0 2 1 0 2 1,313.6886 1,535.17 46,386.4 1107 1119 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% EGPEGFAR R A 97.8% 30.9 25.0 18.8 24.5 0 1 0 0 2 862.4054 1,612.34 50,439.3 548 555 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ELEKDLIDR K H 99.6% 45.7 27.0 25.3 27.1 0 1 0 0 2 1,130.6054 2,078.54 151297 989 997 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ELIPNIPFQMLLR R G 99.7% 49.1 25.0 24.3 43.5 0 3 0 0 2 1,583.8980 4,684.67 50,460.0 632 644 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% ENGVDAVHPGYGFLSER K A 99.7% 31.3 25.4 16.3 30.2 0 0 4 0 2 1,847.8560 3,071.77 107111 108 124 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% FCEVAKENGMDVFR K V 99.7% 45.8 25.0 13.0 45.6 0 0 2 0 2 1,718.7513 2,436.30 82,750.8 662 675 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% FIGPSPEVVR R K 99.7% 55.3 26.0 22.0 45.6 0 2 0 0 2 1,100.6099 2,546.50 116965 138 147 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% GANAVGYTNYPDNVVFK R F 99.7% 82.4 26.4 17.3 79.8 0 6 0 0 2 1,828.8864 3,192.02 89,842.5 645 661 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% GLAPVQAYLHIPDIIK R V 99.7% 30.1 25.0 13.2 29.7 0 0 1 0 2 1,748.0108 4,296.26 25,588.4 89 104 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% GLYAAFDCTATMK R S 99.7% 71.8 25.0 13.1 66.6 0 2 0 0 2 1,464.6499 2,842.40 30,603.7 843 855 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% GQIGAPMPGK K V 99.7% 58.2 25.0 0.000 56.6 0 4 0 0 2 971.4982 1,316.41 425939 1110 1119 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% GTPLDTEVPLER K V 99.7% 58.3 25.0 14.9 50.8 0 2 0 0 2 1,326.6902 2,800.98 539727 819 830 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% HGEEVTPEDVLSAAMYPDVFAQFK R D 99.7% 67.0 27.4 0.000 67.0 0 0 3 0 2 2,680.2601 4,548.99 40,391.1 998 1021 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% HIEVQILGDQYGNILHLYER R D 99.7% 58.9 27.6 13.1 58.9 0 0 4 0 2 2,410.2516 4,157.07 51,718.4 244 263 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% HYFIEVNSR K L 99.0% 35.5 25.0 17.7 35.5 0 2 0 0 2 1,165.5636 2,461.94 38,763.5 320 328 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% IAEEFEVELER K G 99.7% 82.6 26.1 24.0 67.2 0 3 0 0 2 1,363.6740 3,228.00 195749 1044 1054 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% IAPYVAHNFNK K L 99.2% 44.6 26.4 17.3 34.5 0 1 0 0 2 1,273.6687 2,022.18 46,626.3 590 600 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% IEGRPGASLPPLNLK R E 99.6% 35.4 25.0 14.5 24.5 0 1 3 0 2 1,561.9063 2,943.84 310632 974 988 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% INGCAIQCR R V 99.7% 58.8 25.0 18.3 48.0 0 1 0 0 2 1,092.4926 1,541.84 50,866.4 369 377 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% IVGDLAQFMVQNGLSR K A 99.7% 105 27.4 13.1 20.3 0 8 2 0 2 1,764.8951 4,046.09 187588 913 928 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% KAYVEANQMLGDLIK K V 99.6% 31.7 26.7 13.1 28.2 0 0 1 0 2 1,708.8941 2,914.30 31,161.2 892 906 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% KIAPYVAHNFNK K L 99.7% 51.3 26.2 22.3 40.4 0 0 2 0 2 1,401.7637 1,845.06 118546 589 600 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% LDNASAFQGAVISPHYDSLLVK R V 99.7% 72.7 27.6 16.9 67.8 0 0 2 0 2 2,345.2137 3,687.44 375212 407 428 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% LQELRELIPNIPFQMLLR R G 99.6% 27.5 25.0 13.0 27.5 0 0 1 0 2 2,239.2635 4,858.79 6,238.30 627 644 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% NHQGLLLMDTTFR R D 94.9% 22.0 27.3 14.8 21.1 0 0 1 0 2 1,545.7844 3,410.14 26,773.2 559 571 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% QKADEAYLIGR R G 99.7% 61.2 25.3 13.5 57.4 0 2 0 0 2 1,263.6693 2,084.24 84,619.0 78 88 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% QVFFELNGQLR R S 99.7% 50.6 25.1 23.5 43.7 0 4 0 0 2 1,350.7165 3,653.07 280461 1075 1085 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% SFQPDTGRIEVFR R S 98.8% 24.9 26.3 19.0 19.9 0 0 1 0 2 1,551.7915 2,913.82 52,330.1 386 398 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% SILVKDTQAMK R E 97.1% 31.0 25.0 15.9 26.1 0 1 0 0 2 1,249.6823 1,437.31 9,540.80 1086 1096 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% SSSAPVASPNVR R R 99.7% 43.6 25.0 27.6 28.4 0 2 0 0 2 1,171.6064 1,478.38 57,611.6 19 30 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% SVVEFLQGYIGIPHGGFPEPFR R S 99.7% 80.3 27.3 13.0 78.3 0 0 4 0 2 2,446.2556 4,933.79 70,480.7 943 964 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% TKYSLEYYMGLAEELVR R A 99.7% 49.4 27.3 13.0 48.8 0 0 4 0 2 2,081.0261 4,742.60 63,926.6 716 732 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% VAKENGVDAVHPGYGFLSER K A 99.7% 40.1 27.8 0.000 33.8 0 0 2 0 2 2,146.0565 2,846.38 31,385.0 105 124 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% VFDYSEYWEGAR R G 99.7% 91.7 25.0 13.1 76.7 0 2 0 0 2 1,521.6644 3,545.10 95,236.0 831 842 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% VMVANRGEIAIR K V 96.3% 21.4 26.2 19.0 17.9 0 0 2 0 2 1,344.7417 2,002.14 104990 40 51 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% VVEIAPATHLDPQLR K S 99.7% 51.2 25.0 15.6 51.2 0 2 1 0 2 1,658.9226 2,903.44 173183 274 288 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% VVHSYEELEENYTR R A 99.7% 65.0 25.0 13.5 62.3 0 2 2 0 2 1,767.8183 2,578.28 169418 206 219 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 46 64 135 0.531% 46.9% YSLEYYMGLAEELVR K A 99.7% 52.8 26.9 0.000 41.2 0 3 1 0 2 1,835.8884 5,464.58 12,969.8 718 732 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% DVDCAYLR K K 98.0% 34.8 25.0 13.2 31.3 0 2 0 0 2 1,011.4565 2,141.83 72,549.7 231 238 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% EAECVEADSGR R L 99.7% 95.3 25.0 14.7 91.9 0 3 0 0 2 1,222.5005 1,059.18 78,428.6 182 192 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% EYQEVMNSK K L 95.3% 33.7 25.0 0.000 33.7 0 1 0 0 2 1,143.4987 922.716 4,768.80 405 413 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% FAAFIDKVR K F 99.7% 45.4 25.0 13.9 37.1 0 2 0 0 2 1,066.6044 2,712.68 83,440.2 134 142 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% KYEEEVALR K A 99.7% 47.1 25.0 26.0 39.0 0 2 0 0 2 1,136.5946 1,788.89 36,192.1 210 218 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% LAELEGALQK K A 99.6% 43.5 25.4 24.6 6.72 0 1 0 0 2 1,071.6046 2,464.61 106309 385 394 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% LALDIEIATYR K R 99.7% 63.3 25.0 0.000 59.9 0 2 0 0 2 1,277.7101 3,798.95 72,965.0 414 424 Empty true Q6NXH9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% LCEGVGSVNVCVSSSR R G 99.7% 89.9 25.5 13.1 89.9 0 1 0 0 2 1,709.7945 2,528.00 6,026.20 434 449 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% LTAEIENAK R C 99.3% 42.1 27.5 22.5 29.5 0 2 0 0 2 988.5310 1,653.88 90,973.5 349 357 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% NFSSCSAVAPK R T 98.6% 35.1 25.0 14.2 28.3 0 2 0 0 2 1,167.5462 1,689.19 32,669.0 17 27 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% RTKEEINELNR R M 99.7% 55.8 27.1 24.1 43.3 0 0 2 0 2 1,401.7445 1,320.35 64,186.6 334 344 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% SRAEAESWYR R T 98.8% 26.9 25.0 0.000 26.9 0 1 1 0 2 1,254.5860 1,929.03 37,714.0 306 315 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 13 15 27 0.106% 24.5% TKEEINELNR R M 99.7% 42.2 25.8 16.1 29.0 0 3 2 0 2 1,245.6434 1,509.96 189178 335 344 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 100.0% 2 3 4 0.0157% 9.59% ASLENSLEETKGR K Y 99.7% 67.4 27.2 13.3 60.5 0 2 1 0 2 1,433.7231 2,005.81 85,258.9 351 363 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 100.0% 2 3 4 0.0157% 9.59% KNHEEEMLALR K G 99.5% 29.1 25.1 13.3 23.4 0 0 1 0 2 1,385.6843 1,544.16 29,667.9 249 259 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 100.0% 2 3 4 0.0157% 9.59% TRLEQEIATYR K R 99.7% 52.3 26.1 13.2 51.2 0 2 1 0 2 1,379.7278 2,581.63 76,442.1 404 414 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 100.0% 2 3 4 0.0157% 9.59% TRLEQEIATYRR K L 99.7% 39.8 25.9 18.9 31.2 0 0 1 0 2 1,535.8289 2,367.14 63,978.7 404 415 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 100.0% 2 3 4 0.0157% 9.59% VTMQNLNDR K L 99.7% 79.7 25.0 25.5 0.000 0 2 0 0 2 1,106.5260 1,037.07 111764 115 123 Empty false P02535,Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 2 2 4 0.0157% 12.8% GDQALSFLKDFLAGGIAAAVSK M T 99.7% 41.6 25.0 17.1 41.3 0 0 2 0 1 2,221.1866 6,373.67 6,450.40 2 23 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 2 2 4 0.0157% 12.8% GMGGAFVLVLYDEIKK R Y 99.7% 37.7 26.0 15.4 35.7 0 0 2 0 2 1,755.9353 4,414.68 44,886.7 281 296 Empty true P51881 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 5 5 9 0.0354% 5.92% DVAGDASESALLK R C 99.7% 77.8 26.9 20.7 66.1 0 2 0 0 2 1,275.6428 2,521.11 38,307.6 436 448 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 5 5 9 0.0354% 5.92% LNIPVSQVNPR R D 99.7% 47.5 25.0 22.7 28.5 0 2 0 0 2 1,236.7059 2,599.99 53,836.8 638 648 Empty true Q6PIE5 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 5 5 9 0.0354% 5.92% MSVEEVCR K K 99.0% 37.6 25.0 16.7 16.6 0 1 0 0 2 1,025.4390 1,270.65 15,252.8 36 43 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 5 5 9 0.0354% 5.92% VDNSSLTGESEPQTR K S 99.7% 84.2 25.1 19.5 76.7 0 3 0 0 2 1,619.7508 1,642.95 21,619.9 203 217 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 5 5 9 0.0354% 5.92% VIMVTGDHPITAK K A 98.0% 23.8 25.0 16.5 15.3 0 0 1 0 2 1,397.7460 1,958.51 44,222.1 603 615 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 3 3 3 0.0118% 4.81% NYLSSDVEVR R R 96.0% 34.7 25.0 15.8 32.4 0 1 0 0 2 1,181.5796 2,406.72 15,938.6 381 390 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 3 3 3 0.0118% 4.81% TALVERDDFSSGTSSR K S 95.5% 21.5 25.5 15.9 17.5 0 0 1 0 2 1,727.8195 2,027.44 22,140.0 95 110 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 100.0% 3 3 3 0.0118% 4.81% VIFFLPWEK R M 99.7% 50.6 25.0 14.1 46.4 0 1 0 0 2 1,178.6609 4,679.85 7,680.70 340 348 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% AKVNTIPGFDGVVKDADEAVR R I 99.7% 53.6 26.9 15.0 51.4 0 0 2 0 2 2,201.1563 3,306.83 90,464.1 183 203 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% AQAVHPGYGFLSENK R E 99.7% 41.3 26.8 17.5 35.8 0 0 2 0 2 1,617.8020 2,561.31 56,453.4 132 146 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% AQAVHPGYGFLSENKEFAK R R 99.7% 57.1 27.7 0.000 57.1 0 0 2 0 2 2,093.0451 2,820.06 62,760.3 132 150 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% FLSDVYPDGFK K G 99.7% 59.3 25.0 20.4 47.3 0 2 0 0 2 1,287.6257 3,322.74 305301 499 509 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% FSSQEAASSFGDDR R L 99.7% 143 25.0 17.1 141 0 2 0 0 2 1,503.6346 2,285.74 73,609.7 240 253 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% FVKGDISTK R F 98.8% 42.0 25.0 16.3 40.8 0 1 0 0 2 994.5569 1,251.04 36,569.9 490 498 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% GHTLTLSER K N 97.1% 29.5 25.0 0.000 27.6 0 1 0 0 2 1,013.5375 1,588.92 28,613.2 510 518 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% HGNALWLNER K E 99.7% 45.3 25.0 13.6 45.3 0 2 0 0 2 1,209.6123 2,443.48 53,291.3 275 284 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% HIEIQVLGDK R H 99.6% 45.7 25.0 17.6 32.3 0 2 0 0 2 1,151.6421 2,536.68 56,685.1 265 274 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% HKQEDIPISGWAVECR R V 99.7% 44.4 27.2 14.1 37.9 0 0 2 0 2 1,924.9336 2,837.92 135995 380 395 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% IAWDDEETR R D 97.2% 38.5 25.0 13.2 34.1 0 2 0 0 2 1,134.5063 2,228.54 79,114.0 227 235 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% IAWDDEETRDGFR R F 99.1% 24.5 25.0 16.7 18.2 0 0 2 0 2 1,609.7243 2,704.69 302036 227 239 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LAAELNKFMLEK K V 99.7% 47.2 25.0 20.7 44.5 0 1 2 0 2 1,422.7663 2,900.94 84,925.4 638 649 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LAAELNKFMLEKVPK K D 99.7% 35.8 25.0 0.000 35.8 0 0 1 0 2 1,746.9825 2,903.21 33,308.7 638 652 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LHDEDHTVVASNNGPAFTVEVDGSK K L 99.7% 75.3 26.2 13.7 67.3 0 0 4 0 2 2,640.2062 2,688.41 27,485.0 561 585 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LQVEHPVTECITGLDLVQEMILVAK R G 99.7% 43.9 26.5 0.000 41.4 0 0 2 0 2 2,835.4999 4,725.06 18,350.5 350 374 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LSQYQEPIHLPGVR R V 99.7% 47.7 25.4 21.7 42.5 0 2 5 0 2 1,636.8807 3,061.20 1605440 413 426 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% LVTYGSDRAEALK K R 99.2% 25.0 25.2 16.5 22.8 0 0 1 0 2 1,422.7588 1,976.37 39,069.5 448 460 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% MADEAVCVGPAPTSK K S 99.7% 65.0 25.0 13.8 60.4 0 1 0 0 2 1,548.7034 1,857.19 18,079.4 101 115 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% MEDALDNYVIR R G 99.7% 69.4 25.0 17.0 58.5 0 3 0 0 2 1,354.6309 2,964.76 69,461.9 462 472 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% NFYFLEMNTR K L 95.9% 32.0 25.0 0.000 32.0 0 1 0 0 2 1,334.6197 3,896.43 37,716.2 340 349 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% NQLLAIASSVFVASQLR R A 99.7% 125 25.0 17.1 124 0 4 10 0 2 1,817.0279 5,237.25 104433 519 535 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% QAMGEQAVALAK R A 99.7% 95.1 26.4 22.2 79.2 0 2 0 0 2 1,232.6305 1,708.50 179179 310 321 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% RMEDALDNYVIR K G 99.7% 33.5 26.0 18.1 29.4 0 0 2 0 2 1,510.7320 2,695.68 64,353.9 461 472 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% SFGLPSIGR K L 96.6% 32.7 25.0 20.0 32.7 0 3 0 0 2 933.5153 3,220.55 276637 404 412 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% TVAIHSDVDASSVHVK K M 99.7% 64.3 27.3 13.9 62.9 0 0 2 0 2 1,664.8602 1,944.83 92,388.8 85 100 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% VPVIRPDVAK R W 98.3% 45.5 25.0 14.0 34.2 0 2 0 0 2 1,093.6729 1,935.15 76,102.5 545 554 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% VPVIRPDVAKWELSVK R L 99.7% 55.0 25.0 0.000 54.4 0 0 5 0 2 1,836.0743 3,332.67 806833 545 560 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% VVEEAPSIFLDPETR K Q 99.7% 84.1 27.6 13.3 82.2 0 2 0 0 2 1,701.8695 3,572.69 48,581.2 295 309 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% VYAEDPYKSFGLPSIGR R L 99.7% 50.2 27.1 15.5 46.0 0 0 4 0 2 1,898.9648 3,530.72 249979 396 412 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 31 39 85 0.334% 51.0% YSSAGTVEFLVDSQK K N 99.7% 106 25.8 18.0 102 0 4 0 0 2 1,630.7959 3,259.34 67,006.3 325 339 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% AQYEDIAQK K S 99.7% 50.8 25.0 21.6 38.7 0 3 0 0 2 1,065.5212 1,588.79 252526 343 351 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 176 184 Empty false Q3TTY5,P04104,Q8VED5,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% KLLEGEECR R L 99.7% 47.3 25.8 16.9 47.0 0 1 0 0 2 1,133.5621 1,360.47 22,495.8 471 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% LLEGEECR K L 99.0% 49.0 25.0 24.4 37.3 0 2 0 0 2 1,005.4671 1,447.67 73,122.6 472 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 171 182 Empty false Q3TTY5,Q8VED5,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0118% 5.39% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 171 184 Empty false Q3TTY5,Q8VED5,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 99.9% 1 1 2 0.00786% 9.93% EVATNSELVQSGK R S 99.7% 85.4 26.6 14.2 85.4 0 2 0 0 2 1,361.6907 1,645.83 24,012.4 285 297 Empty false Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 99.9% 1 1 2 0.00786% 9.93% LASYLDKVR R A 99.3% 45.2 25.0 13.0 31.8 0 2 0 0 2 1,064.6099 2,155.39 74,554.6 95 103 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 99.9% 1 1 2 0.00786% 9.93% TRLEQEIATYR K R 99.7% 52.3 26.1 13.2 51.2 0 2 1 0 2 1,379.7278 2,581.63 76,442.1 375 385 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 99.9% 1 1 2 0.00786% 9.93% TRLEQEIATYRR K L 99.7% 39.8 25.9 18.9 31.2 0 0 1 0 2 1,535.8289 2,367.14 63,978.7 375 386 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 99.9% 1 1 2 0.00786% 9.93% VLDELTLAR R A 99.7% 61.4 25.6 18.5 50.7 0 2 0 0 2 1,029.5940 2,897.86 98,458.5 193 201 Empty false Q61781,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 163 171 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% KLLEGEECR R L 99.7% 47.3 25.8 16.9 47.0 0 1 0 0 2 1,133.5621 1,360.47 22,495.8 456 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% LLEGEECR K L 99.0% 49.0 25.0 24.4 37.3 0 2 0 0 2 1,005.4671 1,447.67 73,122.6 457 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% SLDLDSIIAEVK R A 99.7% 100 25.8 27.2 86.6 0 4 0 0 2 1,302.7153 4,395.16 138118 316 327 Empty false Q922U2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 158 169 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 99.9% 0 0 0 0.000% 6.33% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 158 171 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2 P56564 Slc1a3 uniprot_Mus-musculus_SP.fasta 59,624.2 99.1% 1 2 4 0.0157% 2.76% IVQVTAADAFLDLIR K N 99.7% 88.5 25.0 13.3 77.0 0 2 2 0 2 1,644.9321 4,990.38 23,496.4 161 175 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 29.6% 0 0 0 0.000% 10.1% LAVNMVPFPR K L 99.7% 69.6 26.8 17.9 65.9 0 2 0 0 2 1,159.6293 3,029.66 64,959.8 253 262 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 29.6% 0 0 0 0.000% 10.1% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 50.0 28.0 14.2 4.89 0 0 4 0 2 2,798.3435 4,368.72 44,560.4 78 103 Empty false P99024,P68372,Q7TMM9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 29.6% 0 0 0 0.000% 10.1% YLTVAAVFR R G 99.7% 45.8 25.0 0.000 45.8 0 2 0 0 2 1,039.5934 3,603.80 75,041.4 310 318 Empty false P99024,P68372 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 3 0.0118% 8.86% EAYPGDVFYLHSR R L 99.3% 48.8 25.3 0.000 48.8 0 1 0 0 2 1,553.7383 3,097.78 10,229.7 335 347 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 3 0.0118% 8.86% EVAAFAQFGSDLDAATQQLLSR R G 95.1% 21.6 27.8 0.000 21.2 0 0 1 0 2 2,338.1675 5,220.26 4,046.10 442 463 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 3 0.0118% 8.86% LKEIVTNFLAGFEP K - 98.4% 32.6 25.1 14.2 32.4 0 1 0 0 2 1,577.8575 4,673.39 8,549.40 540 553 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 5 0.0197% 15.2% ATDLLLDDSLVSLFGNRR K L 99.7% 33.1 26.2 14.8 20.1 0 0 4 0 2 2,005.0715 4,696.48 56,860.1 156 173 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 5 0.0197% 15.2% THLPGFVEQAGALK K A 98.7% 25.2 25.0 13.2 20.6 0 0 1 0 2 1,467.7956 2,982.13 15,954.2 99 112 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 2 2 3 0.0118% 6.17% ATSASSHLNK M G 97.8% 43.8 25.0 15.4 42.8 0 2 0 0 1 1,057.5272 1,222.45 45,059.2 2 11 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 2 2 3 0.0118% 6.17% KDPNKLVLCEVFK R Y 99.5% 28.6 25.4 18.7 28.5 0 0 1 0 2 1,589.8722 3,102.82 29,181.0 91 103 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Q9Z2W8-DECOY Q9Z2W8-DECOY 0.0 99.1% 1 1 1 0.00393% 0.000% GVSVIQELINQLR ? ? 99.7% 31.2 25.0 26.5 19.6 0 0 1 0 2 1,469.8324 5,199.84 6,055.60 0 0 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 2 2 3 0.0118% 4.54% IGLFGGAGVGK K T 99.7% 51.8 25.0 29.2 37.3 0 2 0 0 2 975.5624 3,008.14 43,787.9 202 212 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 2 2 3 0.0118% 4.54% TVLIMELINNVAK K A 99.7% 46.4 25.0 0.000 40.0 0 1 0 0 2 1,457.8397 5,023.11 5,781.20 213 225 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 99.4% 1 1 2 0.00786% 2.31% AILAELTGR R R 99.7% 58.3 26.2 18.9 40.5 0 2 0 0 2 943.5572 3,072.09 43,912.4 133 141 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% ADLEMQIESLKEELAYLK R K 97.2% 28.1 27.6 14.9 26.9 0 0 2 0 2 2,139.0893 4,846.82 18,795.9 239 256 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% EVATNSELVQSGK R S 99.7% 85.4 26.6 14.2 85.4 0 2 0 0 2 1,361.6907 1,645.83 24,012.4 322 334 Empty true Q9QWL7 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% TRLEQEIATYR K R 99.7% 52.3 26.1 13.2 51.2 0 2 1 0 2 1,379.7278 2,581.63 76,442.1 412 422 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% TRLEQEIATYRR K L 99.7% 39.8 25.9 18.9 31.2 0 0 1 0 2 1,535.8289 2,367.14 63,978.7 412 423 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% VLDELTLAR R A 99.7% 61.4 25.6 18.5 50.7 0 2 0 0 2 1,029.5940 2,897.86 98,458.5 230 238 Empty true Q9QWL7,Q6IFX2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 6 7 12 0.0472% 12.6% VTMQNLNDR K L 99.7% 79.7 25.0 25.5 0.000 0 2 0 0 2 1,106.5260 1,037.07 111764 123 131 Empty true Q9Z2K1,P02535 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 4 0.0157% 9.00% IDIPSFDWPIAPFPR K L 99.7% 58.4 26.7 15.8 51.6 0 1 0 0 2 1,770.9216 4,981.40 6,541.70 236 250 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 4 0.0157% 9.00% LKYPLEEFTTDNQQEEAR R C 99.7% 50.0 27.2 0.000 49.4 0 0 2 0 2 2,211.0566 3,180.24 29,164.7 251 268 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 4 0.0157% 9.00% NLLLAEVINIIK K R 99.1% 38.5 25.0 13.9 38.5 0 1 0 0 2 1,352.8513 5,466.81 5,446.20 389 400 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 2 2 4 0.0157% 4.74% IVPNILLEQGK K A 98.7% 36.9 25.0 13.2 33.5 0 2 0 0 2 1,223.7360 3,205.28 59,387.3 383 393 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 2 2 4 0.0157% 4.74% VVPGYGHAVLR R K 99.0% 35.2 25.0 13.3 31.2 0 2 0 0 2 1,167.6633 2,064.76 81,230.9 341 351 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 6 19 0.0747% 5.34% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 199 207 Empty false Q3TTY5,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 6 19 0.0747% 5.34% FLEQQNQVLQTK R W 99.7% 78.6 26.5 24.6 65.3 0 6 0 0 2 1,475.7854 2,428.03 135711 208 219 Empty true Q6NXH9,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 6 19 0.0747% 5.34% RTNAENEFVTIKK K D 99.7% 40.0 26.0 16.0 28.7 0 0 2 0 2 1,549.8333 1,872.10 78,329.0 285 297 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 6 19 0.0747% 5.34% TNAENEFVTIK R K 99.7% 60.7 25.5 17.1 52.5 0 2 0 0 2 1,265.6372 2,575.62 144955 286 296 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 6 19 0.0747% 5.34% TNAENEFVTIKK R D 99.7% 76.0 25.7 15.6 70.8 0 5 4 0 2 1,393.7322 2,098.99 1788340 286 297 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium- and chloride-dependent GABA transporter 3 OS=Mus musculus OX=10090 GN=Slc6a11 PE=1 SV=2 P31650 Slc6a11 uniprot_Mus-musculus_SP.fasta 69,963.1 99.9% 1 1 3 0.0118% 2.55% GSETLGGGGGGAAGTR R E 99.7% 55.8 25.0 13.0 49.6 0 3 0 0 2 1,304.6192 1,180.66 24,928.5 20 35 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Glutathione S-transferase Mu 1 OS=Mus musculus OX=10090 GN=Gstm1 PE=1 SV=2 P10649 Gstm1 uniprot_Mus-musculus_SP.fasta 25,971.9 87.9% 1 1 1 0.00393% 7.80% LGLDFPNLPYLIDGSHK K I 96.0% 29.0 26.9 15.1 22.0 0 0 1 0 2 1,899.0014 4,544.42 10,254.6 53 69 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 93.7% 1 1 2 0.00786% 3.01% FGVEQDVDMVFASFIR K K 97.1% 23.4 26.8 19.3 13.9 0 0 2 0 2 1,859.8997 5,525.56 6,390.80 231 246 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 2 2 3 0.0118% 14.8% IQFNESFAEMNR R G 99.7% 75.2 25.0 0.000 75.2 0 2 0 0 2 1,501.6740 2,792.47 18,836.7 84 95 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 2 2 3 0.0118% 14.8% SEDYAFPTYADRR K D 98.5% 22.8 25.0 13.0 19.5 0 0 1 0 2 1,590.7183 2,549.40 43,075.3 30 42 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 178 186 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% FLEQQNQVLQTK R W 99.7% 78.6 26.5 24.6 65.3 0 6 0 0 2 1,475.7854 2,428.03 135711 187 198 Empty false P04104,Q6NXH9 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% FLEQQNQVLQTKWELLQQVNTSTR R T 99.7% 59.0 27.7 13.1 12.8 0 0 3 0 2 2,932.5166 3,992.88 68,867.7 187 210 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% NKYEDEINKR K T 99.7% 48.0 25.3 16.0 37.5 0 2 5 0 2 1,308.6543 1,435.62 251717 255 264 Empty false Q8VED5,Q922U2 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% QLLEGEESR R M 98.8% 34.6 25.3 30.5 25.4 0 1 0 0 2 1,061.5111 2,601.65 26,988.8 471 479 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 173 184 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 100.0% 2 2 4 0.0157% 9.97% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 173 186 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 7 0.0275% 13.1% DSYVGDEAQSKR K G 97.8% 34.7 25.0 13.3 34.7 0 2 0 0 2 1,354.6234 1,236.59 14,742.5 51 62 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 7 0.0275% 13.1% GYSFTTTAER R E 99.7% 54.6 25.0 13.1 54.2 0 3 0 0 2 1,132.5269 2,146.15 82,720.2 197 206 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 7 0.0275% 13.1% IWHHTFYNELR K V 95.6% 21.2 25.9 0.000 20.8 0 0 1 0 2 1,515.7491 2,730.12 42,750.9 85 95 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 7 0.0275% 13.1% SYELPDGQVITIGNER K F 95.2% 33.6 27.5 0.000 29.3 0 1 0 0 2 1,790.8921 3,628.29 12,986.5 239 254 Empty true Q8BFZ3 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% ALEEANADLEVK R I 99.7% 76.3 26.4 31.2 17.9 0 2 0 0 2 1,301.6584 2,271.89 114063 114 125 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% DAEEWFFTKTEELNR K E 99.7% 38.7 25.0 0.000 27.3 0 0 3 0 2 1,914.8869 3,875.03 84,648.6 280 294 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% NRKDAEEWFFTK K T 94.6% 25.0 25.5 0.000 25.0 0 0 1 0 2 1,570.7649 2,949.37 24,612.8 277 288 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% TKYETELNLR R M 98.3% 42.6 25.0 16.2 35.3 0 1 0 0 2 1,266.6689 2,196.94 54,814.1 181 190 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% TRLEQEIATYR K R 99.7% 52.3 26.1 13.2 51.2 0 2 1 0 2 1,379.7278 2,581.63 76,442.1 385 395 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% TRLEQEIATYRR K L 99.7% 39.8 25.9 18.9 31.2 0 0 1 0 2 1,535.8289 2,367.14 63,978.7 385 396 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 4 4 7 0.0275% 13.5% VLDELTLAR R A 99.7% 61.4 25.6 18.5 50.7 0 2 0 0 2 1,029.5940 2,897.86 98,458.5 203 211 Empty false Q9QWL7,Q61781 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Eukaryotic translation initiation factor 5A-1 OS=Mus musculus OX=10090 GN=Eif5a PE=1 SV=2 P63242 Eif5a uniprot_Mus-musculus_SP.fasta 16,832.7 99.1% 1 1 1 0.00393% 15.6% YDCGEEILITVLSAMTEEAAVAIK K A 99.7% 53.9 28.1 13.1 48.7 0 0 1 0 2 2,626.2993 6,551.87 5,052.40 127 150 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3 Q02257 Jup uniprot_Mus-musculus_SP.fasta 81,801.9 100.0% 1 1 2 0.00786% 2.42% TLVTQNSGVEALIHAILR K A 99.7% 40.8 25.0 13.0 40.8 0 0 2 0 2 1,935.1023 5,131.99 16,064.4 427 444 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Histone H2A type 2-C OS=Mus musculus OX=10090 GN=Hist2h2ac PE=1 SV=3 Q64523,Q6GSS7 Hist2h2aa1,Hist2h2ac uniprot_Mus-musculus_SP.fasta 14,096.0 99.1% 1 1 2 0.00786% 22.5% VGAGAPVYMAAVLEYLTAEILELAGNAAR R D 99.7% 46.5 26.2 16.4 40.6 0 0 2 0 2 2,933.5442 6,646.30 5,445.10 44 72 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% DYQELMNTK R L 99.7% 51.2 25.0 0.000 28.0 0 2 0 0 2 1,157.5145 1,681.93 41,223.7 483 491 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 210 218 Empty false P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% GFSSGSAVVSGGSR R R 99.7% 103 25.0 15.5 96.0 0 2 0 0 2 1,254.6072 1,783.51 105527 23 36 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% KKYEDEINKR K T 99.7% 37.8 25.9 20.5 26.2 0 0 2 0 2 1,322.7064 947.222 21,939.3 287 296 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% KLLEGEECR R M 99.7% 47.3 25.8 16.9 47.0 0 1 0 0 2 1,133.5621 1,360.47 22,495.8 503 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% KYEDEINKR K T 99.1% 37.4 25.0 18.4 27.3 0 1 0 0 2 1,194.6114 1,101.38 7,544.10 288 296 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% LLEGEECR K M 99.0% 49.0 25.0 24.4 37.3 0 2 0 0 2 1,005.4671 1,447.67 73,122.6 504 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% LLRDYQELMNTK R L 96.0% 22.3 25.9 13.8 14.1 0 0 1 0 2 1,539.7838 2,283.73 73,814.5 480 491 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% TLNNKFASFIDK K V 98.3% 27.9 25.0 18.7 24.3 0 0 1 0 2 1,397.7424 3,056.67 16,409.1 205 216 Empty false Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 5 5 8 0.0315% 8.35% TLNNKFASFIDKVR K F 99.7% 56.3 25.0 13.9 53.6 0 0 1 0 2 1,652.9119 3,314.31 111833 205 218 Empty false Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% ESVCQAALGLILK K E 99.7% 83.7 25.8 22.1 78.6 0 2 0 0 2 1,401.7772 4,477.53 56,313.1 502 514 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% HAPLVEFEEEESDK R - 99.7% 60.6 25.0 0.000 60.6 0 2 1 0 2 1,658.7545 2,605.79 39,719.9 704 717 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% IIEEAPAPGINPEVR K R 99.7% 62.8 26.2 13.5 61.7 0 2 0 0 2 1,604.8644 2,642.90 30,671.8 281 295 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% IIEEAPAPGINPEVRR K K 97.6% 23.2 25.2 18.7 18.2 0 0 1 0 2 1,760.9655 2,378.35 46,555.6 281 296 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% IPLSQEEIPLQGHAFEAR K I 99.7% 55.7 26.8 13.0 51.8 0 0 2 0 2 2,035.0609 3,231.05 77,764.4 364 381 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% LVVWASDR K Q 96.8% 31.9 27.8 16.7 19.8 0 1 0 0 2 945.5152 2,577.72 92,287.6 433 440 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% SNVDFLLR R L 98.9% 36.3 25.0 25.4 10.8 0 1 0 0 2 963.5258 3,195.65 29,462.8 461 468 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% VFFSEGAQANR K H 99.7% 53.8 25.0 14.3 49.3 0 3 0 0 2 1,225.5959 2,299.19 65,668.5 693 703 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% VLGDLSSEDGCTYLK R S 99.7% 94.8 25.3 13.2 90.5 0 2 0 0 2 1,656.7788 2,952.53 16,880.5 581 595 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% YCLHQYNIVGLR R S 99.7% 37.4 26.8 16.3 27.8 0 0 2 0 2 1,535.7788 3,025.35 181401 449 460 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% YLSPVSAEGAQGGTIAPMTGTIEK K V 99.2% 28.0 28.0 13.4 22.2 0 0 1 0 2 2,394.1861 2,854.56 12,247.6 632 655 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 12 13 22 0.0865% 21.3% YVGAGTVEFIMDSR K H 99.2% 43.6 25.7 13.4 40.3 0 2 0 0 2 1,560.7364 3,220.92 29,283.9 311 324 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% AYNMLDIIHAVIDER K E 94.8% 21.9 27.2 13.0 21.0 0 0 1 0 2 1,772.9001 5,184.98 6,450.40 315 329 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% FANPFPAAVR K G 98.5% 34.8 27.0 19.4 26.0 0 1 0 0 2 1,089.5839 3,140.88 30,451.6 492 501 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% IQEGVESLAGYADIFLR R N 99.7% 67.7 26.6 0.000 64.8 0 0 2 0 2 1,880.9754 4,883.97 14,181.6 168 184 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% LLYAFAEATVPK K I 99.7% 66.3 25.0 13.6 61.3 0 2 0 0 2 1,322.7355 3,566.30 83,529.5 417 428 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% LVPELDTVVPLESSK R A 99.6% 42.9 25.0 13.1 42.9 0 2 0 0 2 1,625.8998 3,655.07 41,543.4 300 314 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 6 6 11 0.0432% 15.7% SVTNEDVTQEQLGGAK K T 99.7% 96.4 26.7 17.5 81.2 0 3 0 0 2 1,675.8135 1,993.50 32,836.7 235 250 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 91.0% 1 1 1 0.00393% 1.54% SANLVAATLGAILNR R L 97.1% 22.4 25.0 13.7 11.1 0 0 1 0 2 1,483.8591 5,181.91 4,240.50 438 452 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 5 0.0197% 8.04% MQEDIEMTK R T 99.6% 40.6 25.0 23.3 30.8 0 2 0 0 2 1,156.4863 1,071.51 16,142.6 509 517 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 5 0.0197% 8.04% NDEVSSLDAFLDLIR K N 96.7% 33.7 27.2 13.5 31.2 0 1 0 0 2 1,706.8597 5,259.10 4,117.50 159 173 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 5 0.0197% 8.04% SELDTIDSQHR K M 97.7% 23.3 25.0 20.2 21.0 0 0 1 0 2 1,300.6129 1,777.42 67,286.9 498 508 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 5 0.0197% 8.04% TQSIYDDKNHR K E 95.5% 23.2 25.3 16.1 17.3 0 0 1 0 2 1,376.6554 944.522 9,835.80 518 528 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 93.6% 1 1 1 0.00393% 3.28% VAEQTPLTALYVANLIK K E 97.9% 34.1 25.0 0.000 34.1 0 1 0 0 2 1,844.0529 4,653.01 7,566.00 212 228 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0118% 8.22% SYEAYVLNIIR K F 99.7% 64.3 25.0 15.1 55.5 0 2 0 0 2 1,340.7208 4,180.56 46,966.5 97 107 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0118% 8.22% VAPPGLTQIPQIQK R T 95.8% 29.8 25.0 13.8 29.8 0 1 0 0 2 1,489.8740 3,133.40 45,662.9 72 85 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4 P16546 Sptan1 uniprot_Mus-musculus_SP.fasta 284,600.8 99.3% 1 1 1 0.00393% 0.769% IAALQAFADQLIAVDHYAK K G 99.1% 29.9 26.3 20.6 21.7 0 0 1 0 2 2,058.1020 4,888.38 7,326.10 1501 1519 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Protein S100-A6 OS=Mus musculus OX=10090 GN=S100a6 PE=1 SV=3 P14069 S100a6 uniprot_Mus-musculus_SP.fasta 10,051.4 98.0% 1 1 1 0.00393% 19.1% ACPLDQAIGLLVAIFHK M Y 99.4% 39.7 25.0 13.6 35.5 0 1 0 0 1 1,908.0415 6,576.47 3,262.60 2 18 Empty true 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 84.7% 0 0 0 0.000% 7.61% FASFIDKVR K F 99.7% 51.3 25.0 0.000 0.000 0 2 0 0 2 1,082.5993 2,709.06 102435 142 150 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 84.7% 0 0 0 0.000% 7.61% FLEQQNQVLQTK R W 99.7% 78.6 26.5 24.6 65.3 0 6 0 0 2 1,475.7854 2,428.03 135711 151 162 Empty false P04104,Q6IFZ6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 84.7% 0 0 0 0.000% 7.61% KLLEGEECR R M 99.7% 47.3 25.8 16.9 47.0 0 1 0 0 2 1,133.5621 1,360.47 22,495.8 435 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 84.7% 0 0 0 0.000% 7.61% LALDIEIATYR K K 99.7% 63.3 25.0 0.000 59.9 0 2 0 0 2 1,277.7101 3,798.95 72,965.0 424 434 Empty false Q9Z2T6 22-2895 15 15 20220411_bbm1840_22-2895_Killinger_15 (F006911) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 84.7% 0 0 0 0.000% 7.61% LLEGEECR K M 99.0% 49.0 25.0 24.4 37.3 0 2 0 0 2 1,005.4671 1,447.67 73,122.6 436 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% AILVDLEPGTMDSVR R S 98.6% 34.7 27.0 17.5 25.2 0 1 0 0 2 1,631.8312 3,279.12 8,856.40 63 77 Empty true P99024,Q9ERD7 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% EVDEQMLNVQNK K N 99.7% 50.6 25.0 18.4 44.9 0 1 0 0 2 1,462.6844 1,758.59 6,387.70 325 336 Empty true P99024,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% GHYTEGAELVDSVLDVVRK K E 99.7% 43.1 27.6 16.1 42.8 0 0 3 0 2 2,087.0769 4,292.00 47,639.7 104 122 Empty true P99024,Q9ERD7,Q922F4,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% ISEQFTAMFR R R 98.9% 49.7 25.0 0.000 44.2 0 1 0 0 2 1,245.5933 2,895.88 15,854.7 381 390 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% LAVNMVPFPR K L 99.7% 59.2 26.7 18.1 54.0 0 2 0 0 2 1,159.6293 3,035.91 49,470.0 253 262 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% LHFFMPGFAPLTSR R G 99.7% 31.5 26.9 16.4 24.4 0 0 2 0 2 1,620.8356 4,024.53 28,298.0 263 276 Empty true P99024,Q9D6F9,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 57.3 28.0 13.5 46.6 0 0 5 0 2 2,798.3435 4,374.05 43,698.5 78 103 Empty true P99024,Q9D6F9,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 8 10 17 0.0679% 25.8% YLTVAAIFR R G 99.1% 34.8 25.0 0.000 34.0 0 2 0 0 2 1,053.6091 3,980.21 41,776.2 310 318 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 99.9% 1 1 3 0.0120% 3.66% ALMLQGVDLLADAVAVTMGPK R G 99.7% 52.5 25.6 13.1 48.1 0 0 3 0 2 2,113.1399 5,961.72 15,479.0 38 58 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 4 5 13 0.0520% 8.07% ALEESNYELEGK R I 99.7% 82.8 25.0 16.0 81.6 0 3 0 0 2 1,381.6482 2,163.05 88,926.9 164 175 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 4 5 13 0.0520% 8.07% QSLEASLAETEGR K Y 99.7% 98.9 26.0 16.6 84.9 0 2 0 0 2 1,390.6809 2,694.56 131986 385 397 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 4 5 13 0.0520% 8.07% QSVEADINGLR R R 99.7% 55.3 25.0 16.0 44.3 0 2 0 0 2 1,201.6172 2,642.66 36,317.5 244 254 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 4 5 13 0.0520% 8.07% QSVEADINGLRR R V 99.7% 36.9 27.0 26.6 7.79 0 0 6 0 2 1,358.7024 2,412.61 199895 244 255 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 4 5 13 0.0520% 8.07% VTMQNLNDR R L 99.7% 79.5 25.0 23.6 0.000 0 6 0 0 2 1,106.5260 1,051.05 230319 146 154 Empty false Q9Z2K1,Q61781 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 3 3 4 0.0160% 11.0% IGAGDYQPTEQDILR R T 99.7% 57.4 27.0 13.9 48.3 0 2 0 0 2 1,675.8289 2,947.01 18,681.3 163 177 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 3 3 4 0.0160% 11.0% IIHEDGFSGEDVK K Q 97.1% 19.8 25.0 15.1 18.0 0 0 1 0 2 1,445.6909 2,022.57 23,008.0 55 67 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 3 3 4 0.0160% 11.0% LLLLGAGESGK K S 99.7% 44.0 25.0 0.000 0.000 0 1 0 0 2 1,057.6254 2,921.68 26,111.1 36 46 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 4 4 5 0.0200% 12.9% FCTGLTQIETLFK R S 99.7% 65.6 26.3 13.0 65.6 0 2 0 0 2 1,557.7984 4,536.30 25,744.4 253 265 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 4 4 5 0.0200% 12.9% LGFSEVELVQMVVDGVK R L 98.7% 42.9 26.7 0.000 33.8 0 1 0 0 2 1,848.9777 5,339.92 3,188.90 342 358 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 4 4 5 0.0200% 12.9% LLIEMEQR K L 95.5% 34.3 26.3 17.0 24.9 0 1 0 0 2 1,031.5555 2,725.54 19,823.7 359 366 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 4 4 5 0.0200% 12.9% VLTPELYAELR K A 99.5% 38.9 25.0 13.1 25.6 0 1 0 0 2 1,303.7257 3,519.53 18,557.0 33 43 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 2 3 6 0.0240% 16.3% ITVVGVGAVGMACAISILMK K D 99.7% 66.0 25.1 0.000 66.0 0 2 2 0 2 1,990.0900 5,735.05 32,580.6 23 42 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 2 3 6 0.0240% 16.3% LKGYTSWAIGLSVADLAESIMK K N 97.8% 24.9 26.8 13.1 22.8 0 0 2 0 2 2,353.2474 5,687.94 5,000.10 244 265 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) L-lactate dehydrogenase A chain OS=Mus musculus OX=10090 GN=Ldha PE=1 SV=3 P06151 Ldha uniprot_Mus-musculus_SP.fasta 36,498.9 100.0% 2 3 6 0.0240% 16.3% VIGSGCNLDSAR R F 99.7% 72.8 25.2 0.000 53.0 0 2 0 0 2 1,248.6002 1,771.17 21,213.5 158 169 Empty false P16125 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 99.7% 1 1 1 0.00400% 3.10% GGSQGEAVGELPR K G 99.4% 37.7 25.0 0.000 37.7 0 1 0 0 2 1,256.6231 1,986.80 9,668.00 356 368 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 2 2 4 0.0160% 5.19% IAEFAFEYAR R N 99.7% 57.0 25.0 13.6 46.0 0 2 0 0 2 1,216.5996 3,407.43 46,341.3 179 188 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 2 2 4 0.0160% 5.19% MSDGLFLQK R C 99.0% 34.4 25.0 20.0 23.6 0 2 0 0 2 1,054.5240 2,554.53 43,560.7 206 214 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% GRLDSELR R N 95.2% 27.5 26.1 26.7 11.7 0 2 0 0 2 945.5113 1,519.79 114074 232 239 Empty true P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% KLLEGEECR R L 99.7% 50.0 25.8 13.9 47.9 0 1 0 0 2 1,133.5621 1,336.38 11,701.9 466 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% LALDVEIATYR K K 99.7% 71.3 25.2 18.5 37.3 0 3 0 0 2 1,263.6944 3,548.95 95,902.0 455 465 Empty true Q3UV17,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% LLEGEECR K L 99.0% 52.7 25.0 25.1 39.8 0 2 0 0 2 1,005.4671 1,433.09 58,367.0 467 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% LRSEIDNVK R K 97.7% 30.5 26.0 27.1 14.3 0 1 0 0 2 1,073.5950 1,396.71 18,263.4 390 398 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% LRSEIDNVKK R Q 99.7% 34.4 25.0 26.4 4.99 0 0 4 0 2 1,201.6900 1,163.85 146231 390 399 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% NKYEDEINKR K T 99.7% 47.9 25.5 19.6 35.5 0 1 7 0 2 1,308.6543 1,465.91 215940 250 259 Empty true Q8VED5,Q6IFZ6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% SLDLDSIIAEVK R A 99.7% 108 25.8 23.5 93.2 0 4 0 0 2 1,302.7153 4,398.16 74,238.6 326 337 Empty true P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% TTAENEFVMLK R K 98.5% 36.5 25.0 13.0 35.6 0 1 0 0 2 1,298.6298 2,724.42 14,392.0 260 270 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 10 12 28 0.112% 14.0% YEELQQTAGR K H 99.7% 69.3 25.0 24.3 53.6 0 2 0 0 2 1,194.5750 1,562.27 27,087.7 359 368 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 100.0% 1 1 1 0.00400% 3.08% GIFNGFSITLK K E 99.7% 44.9 25.0 13.7 39.5 0 1 0 0 2 1,197.6516 4,253.63 10,101.0 97 107 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% AVLVDLEPGTMDSVR R S 99.7% 55.0 26.9 13.5 37.4 0 2 0 0 2 1,617.8155 3,056.31 16,100.8 63 77 Empty false P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% GHYTEGAELVDAVLDVVR K K 99.7% 44.1 27.1 16.4 40.4 0 0 2 0 2 1,942.9870 4,886.42 17,238.9 104 121 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% IMNTFSVVPSPK R V 95.0% 35.4 26.8 13.1 30.3 0 1 0 0 2 1,335.6978 2,728.33 14,429.1 163 174 Empty false P99024,Q9ERD7,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% ISEQFTAMFR R R 98.9% 49.7 25.0 0.000 44.2 0 1 0 0 2 1,245.5933 2,895.88 15,854.7 381 390 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% LAVNMVPFPR K L 99.7% 59.2 26.7 18.1 54.0 0 2 0 0 2 1,159.6293 3,035.91 49,470.0 253 262 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% LHFFMPGFAPLTSR R G 99.7% 31.5 26.9 16.4 24.4 0 0 2 0 2 1,620.8356 4,024.53 28,298.0 263 276 Empty false P99024,P68372,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 57.3 28.0 13.5 46.6 0 0 5 0 2 2,798.3435 4,374.05 43,698.5 78 103 Empty false P99024,P68372,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 99.1% 1 1 2 0.00799% 25.7% YLTVAAVFR R G 99.7% 57.0 25.0 0.000 57.0 0 2 0 0 2 1,039.5934 3,616.11 51,072.0 310 318 Empty false P99024,P68372 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.1% 1 1 2 0.00799% 6.40% NKYEDEINKR K T 99.7% 47.9 25.5 19.6 35.5 0 1 7 0 2 1,308.6543 1,465.91 215940 228 237 Empty false Q922U2,Q6IFZ6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.1% 1 1 2 0.00799% 6.40% NLDLDSIIAEVK R A 99.7% 68.3 26.0 26.6 54.2 0 2 0 0 2 1,329.7262 4,366.74 68,823.6 304 315 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.1% 1 1 2 0.00799% 6.40% SRAEAESWYQTK K Y 99.7% 30.1 25.0 13.8 29.4 0 1 1 0 2 1,455.6862 1,940.38 26,686.7 325 336 Empty false P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 7 0.0280% 9.52% NMITGTSQADCAVLIVAAGVGEFEAGISK K N 99.7% 86.2 28.5 21.1 76.2 0 0 2 0 2 2,909.4386 5,702.68 8,302.60 101 129 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 7 0.0280% 9.52% THINIVVIGHVDSGK K S 99.7% 51.1 25.4 0.000 47.9 0 0 5 0 2 1,588.8807 2,570.76 97,890.1 6 20 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 28 OS=Mus musculus OX=10090 GN=Krt28 PE=1 SV=1 A6BLY7 Krt28 uniprot_Mus-musculus_SP.fasta 50,346.9 99.1% 1 2 3 0.0120% 1.95% VTMQNLNNR K L 99.7% 63.3 25.0 25.4 0.000 0 3 0 0 2 1,106.5259 1,753.72 170361 86 94 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 3 4 10 0.0400% 6.99% IIAEGANGPTTPEADKIFLER K N 99.7% 57.2 27.5 15.1 51.5 0 0 8 0 2 2,242.1717 3,279.99 127900 400 420 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 3 4 10 0.0400% 6.99% TAAYVNAIEK R V 99.7% 45.2 25.0 13.2 25.2 0 1 0 0 2 1,079.5731 2,080.99 20,364.0 536 545 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 3 4 10 0.0400% 6.99% YNLGLDLR K T 94.8% 28.3 25.0 22.3 7.03 0 1 0 0 2 963.5259 3,185.59 23,522.4 528 535 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% AVLVDLEPGTMDSVR R S 99.7% 55.0 26.9 13.5 37.4 0 2 0 0 2 1,617.8155 3,056.31 16,100.8 63 77 Empty true Q9D6F9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% EVDEQMLNVQNK K N 99.7% 50.6 25.0 18.4 44.9 0 1 0 0 2 1,462.6844 1,758.59 6,387.70 325 336 Empty false P99024,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% GHYTEGAELVDSVLDVVRK K E 99.7% 43.1 27.6 16.1 42.8 0 0 3 0 2 2,087.0769 4,292.00 47,639.7 104 122 Empty false P99024,Q9ERD7,Q922F4,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% IMNTFSVVPSPK R V 95.0% 35.4 26.8 13.1 30.3 0 1 0 0 2 1,335.6978 2,728.33 14,429.1 163 174 Empty true P99024,Q9ERD7,Q9D6F9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% ISEQFTAMFR R R 98.9% 49.7 25.0 0.000 44.2 0 1 0 0 2 1,245.5933 2,895.88 15,854.7 381 390 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% LAVNMVPFPR K L 99.7% 59.2 26.7 18.1 54.0 0 2 0 0 2 1,159.6293 3,035.91 49,470.0 253 262 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% LHFFMPGFAPLTSR R G 99.7% 31.5 26.9 16.4 24.4 0 0 2 0 2 1,620.8356 4,024.53 28,298.0 263 276 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 57.3 28.0 13.5 46.6 0 0 5 0 2 2,798.3435 4,374.05 43,698.5 78 103 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 100.0% 3 3 5 0.0200% 28.5% YLTVAAVFR R G 99.7% 57.0 25.0 0.000 57.0 0 2 0 0 2 1,039.5934 3,616.11 51,072.0 310 318 Empty true P99024,Q9D6F9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Heat shock protein HSP 90-alpha OS=Mus musculus OX=10090 GN=Hsp90aa1 PE=1 SV=4 P07901 Hsp90aa1 uniprot_Mus-musculus_SP.fasta 84,791.2 99.1% 1 1 3 0.0120% 3.68% DLVILLYETALLSSGFSLEDPQTHANR K I 99.7% 94.4 28.0 17.4 87.1 0 0 3 0 2 3,002.5472 5,997.15 5,138.10 662 688 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% AVFVDLEPTVIDEVR R T 99.7% 55.4 26.5 19.1 38.8 0 2 0 0 2 1,701.9059 4,102.37 42,710.3 65 79 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 41.3 26.9 13.0 39.0 0 0 3 0 2 2,766.2862 3,403.58 19,656.1 281 304 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% DVNAAIATIK K T 99.7% 47.0 26.8 18.8 37.4 0 2 0 0 2 1,015.5783 2,524.90 54,679.5 327 336 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% EIIDLVLDR K I 99.7% 40.8 25.0 19.2 29.6 0 2 0 0 2 1,085.6203 3,814.82 27,032.1 113 121 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% IHFPLATYAPVISAEK R A 99.7% 35.6 25.4 13.9 26.8 0 0 1 0 2 1,756.9633 3,791.72 33,813.4 265 280 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% LIGQIVSSITASLR R F 99.7% 100 25.0 0.000 100 0 2 2 0 2 1,457.8687 4,793.59 41,078.8 230 243 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% NLDIERPTYTNLNR R L 96.2% 20.8 27.6 24.0 14.9 0 0 1 0 2 1,718.8821 2,600.02 30,740.6 216 229 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% QLFHPEQLITGK R E 99.5% 28.0 25.0 17.6 26.3 0 0 2 0 2 1,410.7742 3,152.83 36,456.3 85 96 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% TIGGGDDSFNTFFSETGAGK K H 99.7% 44.9 25.0 0.000 44.9 0 1 0 0 2 2,007.8933 3,805.48 4,011.70 41 60 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% TIQFVDWCPTGFK R V 99.7% 44.3 25.4 13.2 44.3 0 3 0 0 2 1,598.7674 4,055.44 29,849.2 340 352 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% VGINYQPPTVVPGGDLAK K V 99.4% 43.6 25.0 13.0 41.8 0 2 0 0 2 1,824.9857 3,238.85 41,831.3 353 370 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 7 0.0280% 38.6% YMACCLLYR K G 99.7% 44.7 25.0 0.000 44.7 0 2 0 0 2 1,265.5476 2,753.02 33,516.8 312 320 Empty false P68368,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1 Q9DB77 Uqcrc2 uniprot_Mus-musculus_SP.fasta 48,236.0 95.1% 1 1 2 0.00799% 2.21% AVAFQNSQTR K I 98.4% 37.4 25.8 14.7 34.1 0 2 0 0 2 1,121.5697 1,440.96 20,049.6 163 172 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 1 1 2 0.00799% 5.38% GVGIISEGNETVEDIAAR K L 99.7% 78.6 27.0 19.5 75.3 0 2 0 0 2 1,829.9241 3,424.92 26,254.3 630 647 Empty false Q6PIC6,Q6PIE5 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 1 1 2 0.00799% 5.38% NMVPQQALVIR K N 96.2% 29.0 25.0 17.5 18.1 0 1 0 0 2 1,284.7094 2,500.97 20,186.2 163 173 Empty false Q6PIC6,Q6PIE5 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 1 1 2 0.00799% 5.38% SPDFTNENPLETR R N 99.7% 79.5 25.0 16.9 78.1 0 2 0 0 2 1,519.7024 2,803.60 16,862.5 228 240 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 100.0% 1 1 2 0.00799% 5.38% VIMVTGDHPITAK K A 99.7% 37.7 25.0 19.8 36.0 0 0 1 0 2 1,397.7460 1,941.61 28,487.1 613 625 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Peroxiredoxin-2 OS=Mus musculus OX=10090 GN=Prdx2 PE=1 SV=3 Q61171 Prdx2 uniprot_Mus-musculus_SP.fasta 21,779.1 89.2% 1 1 1 0.00400% 5.56% QITVNDLPVGR R S 96.3% 28.3 25.0 0.000 28.3 0 1 0 0 2 1,211.6744 2,810.19 12,508.8 140 150 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 2 2 4 0.0160% 9.58% ITVVGVGQVGMACAISILGK K S 99.7% 41.0 25.0 0.000 41.0 0 0 2 0 2 1,973.0925 4,922.44 20,456.2 24 43 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 100.0% 2 2 4 0.0160% 9.58% VIGSGCNLDSAR R F 99.7% 72.8 25.2 0.000 53.0 0 2 0 0 2 1,248.6002 1,771.17 21,213.5 159 170 Empty true P06151 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% AIGIGAYLVR R L 99.7% 60.9 25.0 20.9 0.000 0 2 0 0 2 1,032.6201 3,489.37 58,696.6 1823 1832 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% ATLVEHGIR K R 98.6% 32.0 25.0 13.6 26.9 0 2 0 0 2 995.5633 1,540.83 77,564.1 1316 1324 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% AVVMDLLR K Q 99.0% 44.1 25.0 26.0 23.5 0 4 0 0 2 932.5235 3,078.31 67,359.4 984 991 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% AYIAYELNSVQHR R Q 99.7% 53.0 26.0 13.1 52.0 0 2 0 0 2 1,563.7913 2,742.32 14,827.7 1156 1168 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% DEPIHILNVAIK R T 99.7% 62.3 25.0 17.2 50.5 0 2 3 0 2 1,361.7789 3,488.07 140339 1282 1293 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% DKFEEDRIYR R H 99.3% 27.0 25.0 14.4 20.7 0 0 2 0 2 1,370.6700 1,877.23 57,965.2 1361 1370 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% EASFEYLQNEGER K L 99.7% 57.4 25.0 0.000 51.2 0 2 0 0 2 1,571.6972 2,695.81 36,319.7 1435 1447 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% EGLPLMVFANWR R G 99.3% 49.0 27.1 20.4 47.6 0 1 0 0 2 1,432.7406 4,897.75 8,398.30 2035 2046 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% EVFFMNTQSIVQLVQR R Y 98.9% 24.9 27.1 0.000 17.6 0 0 2 0 2 1,955.0056 4,210.59 27,524.8 958 973 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% FGAYIVDGLR K E 99.7% 53.4 25.0 18.5 53.4 0 1 0 0 2 1,110.5943 3,371.57 46,007.7 2062 2071 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% FVVMVTPEDLK R A 99.7% 50.1 25.6 16.1 41.7 0 4 0 0 2 1,277.6811 3,383.93 72,444.3 152 162 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% GGSWVVIDPTINPR R H 99.7% 49.2 25.0 13.7 31.1 0 2 0 0 2 1,510.8014 3,536.82 38,516.5 2089 2102 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% GQVLPAHTLLNTVDVELIYEGIK R Y 99.7% 44.1 25.0 13.0 44.1 0 0 2 0 2 2,522.3868 4,699.25 51,060.2 657 679 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% GVINDILDWK K T 99.7% 80.7 26.0 26.6 66.2 0 2 0 0 2 1,172.6312 4,372.30 21,366.3 2199 2208 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% HLEPALAFQLELNR R M 99.7% 50.1 25.5 18.1 27.6 0 0 2 0 2 1,650.8963 3,736.67 38,416.8 1371 1384 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% HLEVQILADQYGNAISLFGR R D 99.4% 25.5 27.4 0.000 25.5 0 0 1 0 2 2,244.1773 4,564.92 10,833.8 356 375 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% HMFHVAWVDPEDPYK R G 99.6% 25.2 25.0 0.000 24.8 0 0 3 0 2 1,886.8532 3,108.56 47,850.4 1731 1745 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IDTGWLDR R L 99.0% 50.9 26.5 27.1 24.6 0 2 0 0 2 975.4896 2,877.91 36,511.2 607 614 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IGLAEEIR R H 99.0% 55.4 25.0 31.2 34.7 0 2 0 0 2 900.5150 2,486.14 51,044.4 1723 1730 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IGSFGPQEDLLFLR R A 99.7% 84.9 25.5 13.4 81.6 0 2 0 0 2 1,591.8481 4,390.28 59,524.5 1687 1700 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IIEFVPTK R A 98.4% 32.5 25.0 15.6 25.0 0 1 0 0 2 946.5609 2,774.83 21,657.1 1921 1928 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IIQQAGQVWFPDSAFK K T 99.7% 78.0 27.2 13.1 72.1 0 2 0 0 2 1,834.9488 3,902.27 28,191.2 2009 2024 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% ILNVPQDLYEK R G 97.6% 31.6 26.3 18.4 31.1 0 1 0 0 2 1,331.7207 3,106.07 29,960.1 277 287 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IPVQAVWAGWGHASENPK R L 99.7% 51.7 27.5 13.1 51.3 0 0 1 0 2 1,946.9872 3,524.24 20,840.3 199 216 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% ITDIIGKEEGLGAENLR K G 99.7% 44.0 26.0 21.1 36.3 0 0 2 0 2 1,827.9814 2,964.30 41,301.3 1781 1797 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% ITSENPDEGFKPSSGTVQELNFR R S 99.7% 60.4 27.4 14.7 57.2 0 0 4 0 2 2,552.2265 3,050.15 57,091.0 509 531 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% IYVAANSGAR R I 99.7% 48.2 25.1 26.2 39.1 0 3 0 0 2 1,022.5265 1,474.59 69,635.4 1713 1722 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% KVNNADDFPNLFR R Q 99.7% 35.0 26.7 20.6 24.9 0 0 2 0 2 1,549.7758 3,292.42 52,982.5 322 334 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% LGGIPVGVVAVETR R T 99.7% 62.3 25.0 13.1 49.2 0 2 0 0 2 1,366.8054 3,353.27 100545 1977 1990 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% LLETESFQLNR K I 99.7% 58.5 26.5 19.1 44.5 0 2 0 0 2 1,349.7060 2,974.89 43,646.1 596 606 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% LTFLVAQK R D 99.0% 35.1 25.0 23.2 23.0 0 2 0 0 2 919.5612 2,888.27 55,267.4 1326 1333 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% MAALEVYVR R R 99.7% 47.1 25.0 15.5 29.2 0 2 0 0 2 1,067.5554 2,583.48 58,869.4 1146 1154 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% MGGMVSFR R T 99.0% 56.0 25.0 17.6 38.6 0 2 0 0 2 916.4016 1,545.69 53,659.2 1232 1239 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% MQLDNPSK K V 99.0% 36.1 25.0 21.8 25.0 0 2 0 0 2 948.4457 904.258 16,044.0 817 824 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% NSISNFLHSLER R G 99.7% 54.7 26.6 16.3 47.8 0 2 4 0 2 1,416.7229 4,061.25 128772 645 656 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% QGPLHGMLINTPYVTK K D 99.7% 29.8 26.4 0.000 21.6 0 0 2 0 2 1,784.9367 2,749.37 82,811.8 1564 1579 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% QVLIASHLPSYELR R H 99.7% 48.0 25.0 13.0 44.5 0 2 1 0 2 1,625.9010 3,224.71 45,068.7 1082 1095 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% RAYIAYELNSVQHR R Q 99.7% 67.9 26.9 16.8 60.3 0 0 2 0 2 1,719.8924 2,531.02 53,429.6 1155 1168 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% SVHSSVPLLNSKDPIDR K I 99.7% 33.0 26.3 13.0 33.0 0 0 2 0 2 1,863.9924 2,549.46 75,005.0 1904 1920 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% TAQIMFQAYGDK R Q 99.7% 68.5 25.0 0.000 68.5 0 2 0 0 2 1,388.6517 2,520.97 36,136.7 1552 1563 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% TDGDIEDDRLAAMFR K E 99.0% 25.6 25.0 13.5 23.2 0 0 2 0 2 1,740.7861 2,825.13 79,563.7 1294 1308 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% TIQVENSHLILTGAGALNK R V 99.7% 46.0 25.0 13.3 0.380 0 0 2 0 2 1,979.0922 3,156.25 56,554.7 1837 1855 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% TLRDPSLPLLELQDIMTSVSGR K I 99.7% 63.8 26.0 13.4 60.7 0 0 2 0 2 2,441.3072 5,270.08 24,524.5 887 908 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% TTVEYLIK R L 95.0% 28.4 25.0 28.4 27.1 0 2 0 0 2 966.5507 2,636.29 36,790.5 588 595 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VETQFQNGHYDK R C 99.7% 33.6 25.0 18.7 0.000 0 0 2 0 2 1,466.6548 1,662.67 46,908.3 996 1007 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VEVGTEVTDYR K F 99.7% 81.7 25.0 20.8 81.7 0 2 0 0 2 1,267.6165 2,298.19 75,730.9 1409 1419 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VLIANNGIAAVK K C 99.7% 55.3 25.0 19.0 11.9 0 2 0 0 2 1,183.7046 2,714.14 44,853.2 120 131 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VNNADDFPNLFR K Q 99.3% 40.0 25.6 0.000 40.0 0 1 0 0 2 1,421.6808 3,661.61 17,128.5 323 334 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VQQAELHTGSLPQIQSTALR K G 99.7% 88.5 26.4 13.3 83.7 0 0 2 0 2 2,177.1675 2,933.14 110514 825 844 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% VSALNSVHCEHVEDEGESR R Y 99.7% 55.5 25.0 14.9 55.5 0 0 3 0 2 2,153.9516 1,802.41 31,412.5 1760 1778 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% YLYLTPQDYK K R 98.6% 36.0 25.9 13.6 36.0 0 1 0 0 2 1,303.6570 3,068.31 27,943.8 1749 1758 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 60 113 0.452% 27.5% YLYLTPQDYKR K V 96.8% 21.0 26.6 15.9 15.5 0 0 2 0 2 1,459.7581 2,731.88 68,304.8 1749 1759 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Serum albumin OS=Mus musculus OX=10090 GN=Alb PE=1 SV=3 P07724 Alb uniprot_Mus-musculus_SP.fasta 68,692.9 100.0% 2 2 4 0.0160% 4.44% ECCHGDLLECADDR K A 99.7% 48.2 25.0 0.000 48.2 0 0 2 0 2 1,749.6628 2,089.70 61,512.9 268 281 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Serum albumin OS=Mus musculus OX=10090 GN=Alb PE=1 SV=3 P07724 Alb uniprot_Mus-musculus_SP.fasta 68,692.9 100.0% 2 2 4 0.0160% 4.44% LGEYGFQNAILVR K Y 99.7% 105 25.3 17.6 89.8 0 2 0 0 2 1,479.7955 3,646.68 151558 422 434 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 90.4% 1 1 1 0.00400% 3.34% IAVAAQNCYK K V 96.8% 32.4 25.0 13.0 32.2 0 1 0 0 2 1,137.5721 1,687.35 10,105.4 110 119 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 4 4 6 0.0240% 2.99% LHIIEVGTPPTGNQPFPK K K 99.7% 28.6 25.5 13.5 25.6 0 0 1 0 2 1,945.0545 3,173.73 17,043.1 228 245 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 4 4 6 0.0240% 2.99% LLLPWLEAR K I 97.2% 38.4 25.0 20.2 32.9 0 1 0 0 2 1,110.6671 4,482.62 11,001.0 857 865 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 4 4 6 0.0240% 2.99% LLYNNVSNFGR K L 99.7% 53.0 25.7 0.000 53.0 0 2 0 0 2 1,296.6694 2,916.92 32,925.1 1216 1226 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 4 4 6 0.0240% 2.99% NLQNLLILTAIK R A 99.7% 51.5 25.0 13.0 47.2 0 2 0 0 2 1,353.8466 4,548.19 21,069.4 1023 1034 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Eukaryotic translation initiation factor 5A-1 OS=Mus musculus OX=10090 GN=Eif5a PE=1 SV=2 P63242 Eif5a uniprot_Mus-musculus_SP.fasta 16,832.7 99.1% 1 1 2 0.00799% 15.6% YDCGEEILITVLSAMTEEAAVAIK K A 99.7% 64.1 27.9 15.2 58.5 0 0 2 0 2 2,626.2993 6,548.45 15,324.4 127 150 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 41.3 26.9 13.0 39.0 0 0 3 0 2 2,766.2862 3,403.58 19,656.1 281 304 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% DVNAAIAAIK K T 99.7% 51.0 25.0 0.000 42.4 0 2 0 0 2 985.5677 2,765.95 34,992.3 327 336 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% IHFPLATYAPVISAEK R A 99.7% 35.6 25.4 13.9 26.8 0 0 1 0 2 1,756.9633 3,791.72 33,813.4 265 280 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% LISQIVSSITASLR R F 99.7% 50.6 25.0 13.1 50.6 0 2 2 0 2 1,487.8792 4,954.45 30,964.1 230 243 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% NLDIERPTYTNLNR R L 96.2% 20.8 27.6 24.0 14.9 0 0 1 0 2 1,718.8821 2,600.02 30,740.6 216 229 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% QLFHPEQLITGK R E 99.5% 28.0 25.0 17.6 26.3 0 0 2 0 2 1,410.7742 3,152.83 36,456.3 85 96 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% SIQFVDWCPTGFK R V 95.9% 28.5 25.0 0.000 28.5 0 1 0 0 2 1,584.7517 4,049.90 6,022.90 340 352 Empty false P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% VGINYQPPTVVPGGDLAK K V 99.4% 43.6 25.0 13.0 41.8 0 2 0 0 2 1,824.9857 3,238.85 41,831.3 353 370 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00799% 29.0% YMACCLLYR K G 99.7% 44.7 25.0 0.000 44.7 0 2 0 0 2 1,265.5476 2,753.02 33,516.8 312 320 Empty false P68369,P05213 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% AVFVDLEPTVIDEVR R T 99.7% 55.4 26.5 19.1 38.8 0 2 0 0 2 1,701.9059 4,102.37 42,710.3 65 79 Empty true P68369 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% AYHEQLSVAEITNACFEPANQMVK K C 99.7% 41.3 26.9 13.0 39.0 0 0 3 0 2 2,766.2862 3,403.58 19,656.1 281 304 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% DVNAAIATIK K T 99.7% 47.0 26.8 18.8 37.4 0 2 0 0 2 1,015.5783 2,524.90 54,679.5 327 336 Empty true P68369 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% EIIDLVLDR K I 99.7% 40.8 25.0 19.2 29.6 0 2 0 0 2 1,085.6203 3,814.82 27,032.1 113 121 Empty true P68369 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% IHFPLATYAPVISAEK R A 99.7% 35.6 25.4 13.9 26.8 0 0 1 0 2 1,756.9633 3,791.72 33,813.4 265 280 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% LISQIVSSITASLR R F 99.7% 50.6 25.0 13.1 50.6 0 2 2 0 2 1,487.8792 4,954.45 30,964.1 230 243 Empty true P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% NLDIERPTYTNLNR R L 96.2% 20.8 27.6 24.0 14.9 0 0 1 0 2 1,718.8821 2,600.02 30,740.6 216 229 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% QLFHPEQLITGK R E 99.5% 28.0 25.0 17.6 26.3 0 0 2 0 2 1,410.7742 3,152.83 36,456.3 85 96 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% SIQFVDWCPTGFK R V 95.9% 28.5 25.0 0.000 28.5 0 1 0 0 2 1,584.7517 4,049.90 6,022.90 340 352 Empty true P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% TIGGGDDSFNTFFSETGAGK K H 99.7% 44.9 25.0 0.000 44.9 0 1 0 0 2 2,007.8933 3,805.48 4,011.70 41 60 Empty true P68369 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% VGINYQPPTVVPGGDLAK K V 99.4% 43.6 25.0 13.0 41.8 0 2 0 0 2 1,824.9857 3,238.85 41,831.3 353 370 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 12 13 23 0.0919% 38.6% YMACCLLYR K G 99.7% 44.7 25.0 0.000 44.7 0 2 0 0 2 1,265.5476 2,753.02 33,516.8 312 320 Empty true P68369,P68368 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 4 4 7 0.0280% 11.4% ASAELALGENNEVLK K S 99.5% 46.6 26.5 18.2 41.8 0 2 0 0 2 1,557.8119 2,864.03 13,729.1 108 122 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 4 4 7 0.0280% 11.4% FVTVQTISGTGALR R V 99.7% 68.7 25.0 13.1 68.7 0 2 0 0 2 1,449.8061 3,078.66 27,604.9 126 139 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 4 4 7 0.0280% 11.4% IAATILTSPDLR R K 99.7% 67.8 25.0 13.6 60.8 0 2 0 0 2 1,270.7367 3,140.95 39,994.6 326 337 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 4 4 7 0.0280% 11.4% VGASFLQR R F 99.0% 62.1 25.0 33.2 37.1 0 1 0 0 2 877.4890 2,315.91 21,211.3 140 147 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 99.3% 1 1 2 0.00799% 4.19% TATFAISILQQIELDLK K A 99.7% 73.4 25.0 15.1 61.8 0 2 0 0 2 1,904.0742 5,797.18 4,068.60 83 99 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 2 2 3 0.0120% 4.39% FYFENLWSR R N 99.3% 40.7 25.0 0.000 32.9 0 1 0 0 2 1,261.5999 4,234.90 9,120.90 397 405 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 2 2 3 0.0120% 4.39% ITQYLDAGGIPR R T 99.7% 64.9 25.9 19.8 64.3 0 2 0 0 2 1,303.7007 2,808.87 31,753.0 434 445 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 6 0.0240% 7.38% ISQLYGDLK K H 98.7% 35.5 25.0 21.0 27.4 0 1 0 0 2 1,036.5675 2,489.65 20,277.3 539 547 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 6 0.0240% 7.38% LGANSLLDLVVFGR R A 99.7% 75.5 25.0 13.0 75.5 0 2 0 0 2 1,473.8425 5,154.02 15,839.2 452 465 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 6 0.0240% 7.38% VDEYDYSKPIQGQQK R K 99.7% 32.3 26.6 13.1 23.3 0 0 1 0 2 1,797.8656 1,928.57 15,253.6 601 615 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 6 0.0240% 7.38% VGSVLQEGCEK R I 99.7% 58.3 25.5 18.4 52.5 0 2 0 0 2 1,205.5832 1,692.04 19,768.4 528 538 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 3 3 4 0.0160% 10.1% GCDVVVIPAGVPR K K 99.4% 38.0 25.0 17.1 33.4 0 1 0 0 2 1,338.7200 3,061.22 27,251.8 92 104 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 3 3 4 0.0160% 10.1% IFGVTTLDIVR K A 99.6% 41.1 25.0 15.0 35.3 0 1 0 0 2 1,233.7203 3,982.72 17,684.9 166 176 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 3 3 4 0.0160% 10.1% IQEAGTEVVK R A 98.6% 35.2 26.9 33.8 1.39 0 2 0 0 2 1,073.5838 1,491.77 40,023.1 230 239 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 99.9% 1 1 1 0.00400% 1.99% TTLTAAITK K I 98.2% 30.8 25.0 15.6 27.6 0 1 0 0 2 919.5460 2,232.69 23,353.2 71 79 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 1 1 1 0.00400% 2.82% SVINLLFAAYTGDVSALRR K F 99.7% 42.9 25.0 0.000 39.7 0 0 1 0 2 2,066.1393 5,150.36 9,852.40 558 576 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ACTELGIR R T 98.9% 35.1 26.1 25.8 22.8 0 1 0 0 2 919.4667 1,866.63 29,346.1 55 62 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ADEAYLIGR K G 98.2% 32.2 25.8 17.4 23.8 0 2 0 0 2 1,007.5157 2,435.13 82,060.0 80 88 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ADFAQACQDAGVR R F 99.7% 81.9 25.0 16.8 70.8 0 2 0 0 2 1,408.6275 2,110.55 43,165.7 125 137 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% AEAEAQAEELSFPR R S 99.7% 113 25.3 15.5 102 0 4 2 0 2 1,547.7336 2,827.83 214918 929 942 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% AGTHILCIK R D 99.7% 44.5 25.0 16.1 40.5 0 2 0 0 2 1,012.5610 2,037.53 88,926.2 733 741 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ALAVSDLNR K A 99.7% 54.4 25.0 15.1 31.1 0 6 0 0 2 958.5316 2,177.74 683624 1062 1070 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% AYSEALAAFGNGALFVEK R F 99.7% 92.0 27.2 18.8 83.0 0 11 5 0 2 1,858.9222 4,268.33 141573 220 237 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% AYVEANQMLGDLIK K V 99.7% 87.9 26.6 20.5 80.4 0 4 0 0 2 1,580.7991 3,266.02 34,219.1 893 906 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% DAHQSLLATR R V 99.7% 53.4 25.0 23.1 44.5 0 1 0 0 2 1,111.5855 1,733.51 205307 572 581 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% DFTATFGPLDSLNTR K L 99.7% 75.4 26.1 17.7 68.4 0 6 0 0 2 1,654.8073 3,964.16 141373 1022 1036 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% DMAGLLKPAACTMLVSSLR K D 99.7% 45.0 27.6 17.1 36.8 0 0 2 0 2 2,066.0445 3,336.28 227596 742 760 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% DTQAMKEMHFHPK K A 99.3% 24.1 25.0 0.000 24.1 0 0 2 0 2 1,631.7307 887.997 128329 1091 1103 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% EGPEGFAR R A 99.0% 39.5 25.0 18.9 25.5 0 3 0 0 2 862.4054 1,595.71 180104 548 555 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ELEKDLIDR K H 99.7% 59.8 27.0 29.5 38.1 0 4 0 0 2 1,130.6054 2,029.28 351877 989 997 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ELIPNIPFQMLLR R G 99.7% 65.7 25.0 27.2 61.8 0 2 0 0 2 1,583.8980 5,046.29 148344 632 644 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ENGMDVFR K V 97.3% 33.8 25.0 22.6 15.0 0 1 0 0 2 983.4252 1,704.61 19,612.0 668 675 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% ENGVDAVHPGYGFLSER K A 99.7% 36.9 25.2 15.4 33.0 0 0 5 0 2 1,847.8560 3,094.97 122321 108 124 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% FCEVAKENGMDVFR K V 99.7% 40.2 25.0 0.000 40.2 0 0 4 0 2 1,718.7513 2,660.69 107401 662 675 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% FIGPSPEVVR R K 99.7% 53.8 26.0 23.2 45.9 0 2 0 0 2 1,100.6099 2,537.96 128287 138 147 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% FIGPSPEVVRK R M 96.4% 19.1 25.0 22.1 9.03 0 0 1 0 2 1,228.7049 2,143.14 39,126.0 138 148 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% GANAVGYTNYPDNVVFK R F 99.7% 101 26.3 14.1 95.4 0 6 0 0 2 1,828.8864 3,196.34 256222 645 661 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% GLYAAFDCTATMK R S 99.7% 80.4 25.0 13.1 77.4 0 3 0 0 2 1,464.6499 2,833.36 36,049.5 843 855 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% GQIGAPMPGK K V 99.7% 56.0 25.0 13.1 56.0 0 4 0 0 2 971.4982 1,302.87 367659 1110 1119 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% GTPLDTEVPLER K V 99.7% 53.1 25.3 14.2 49.8 0 2 0 0 2 1,326.6902 2,786.57 257028 819 830 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% HGEEVTPEDVLSAAMYPDVFAQFK R D 99.7% 64.6 26.2 13.1 61.6 0 0 5 0 2 2,680.2601 4,536.62 112834 998 1021 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% HIEVQILGDQYGNILHLYER R D 99.7% 73.7 27.7 13.8 73.7 0 0 9 0 2 2,410.2516 4,226.65 104560 244 263 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% HYFIEVNSR K L 99.1% 36.4 25.0 23.3 31.3 0 4 0 0 2 1,165.5636 2,385.60 82,164.1 320 328 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% IAEEFEVELER K G 99.7% 82.2 26.3 21.4 65.8 0 5 0 0 2 1,363.6740 3,406.24 183612 1044 1054 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% IAPYVAHNFNK K L 99.7% 44.5 26.1 17.6 31.4 0 2 0 0 2 1,273.6687 2,015.89 64,263.6 590 600 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% IEGRPGASLPPLNLK R E 99.7% 49.3 25.0 13.9 44.0 0 2 3 0 2 1,561.9063 2,917.16 839870 974 988 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% INGCAIQCR R V 99.7% 70.2 25.0 22.0 50.5 0 2 0 0 2 1,092.4926 1,522.76 122399 369 377 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% IVGDLAQFMVQNGLSR K A 99.7% 98.0 27.3 13.2 17.2 0 6 1 0 2 1,748.9002 3,582.38 97,148.4 913 928 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% KAYVEANQMLGDLIK K V 99.5% 25.5 26.7 16.3 23.6 0 0 2 0 2 1,708.8941 2,900.50 50,702.1 892 906 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% KIAPYVAHNFNK K L 99.7% 54.3 25.9 15.5 50.3 0 0 5 0 2 1,401.7637 1,853.11 153097 589 600 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% LDNASAFQGAVISPHYDSLLVK R V 99.7% 78.5 27.5 15.8 72.1 0 0 5 0 2 2,345.2137 3,792.40 297558 407 428 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% LFSMENWGGATFDVAMR K F 94.9% 26.8 25.0 0.000 26.8 0 1 0 0 2 1,931.8779 4,499.49 5,317.20 601 617 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% NHQGLLLMDTTFR R D 99.7% 35.2 26.9 0.000 34.0 0 0 3 0 2 1,545.7844 3,422.63 67,135.3 559 571 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% QKADEAYLIGR R G 99.7% 53.9 25.8 13.5 51.3 0 2 0 0 2 1,263.6693 2,100.01 61,697.9 78 88 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% QVFFELNGQLR R S 99.7% 57.1 25.2 21.7 44.7 0 6 0 0 2 1,350.7165 3,706.20 252117 1075 1085 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% QVGYENAGTVEFLVDK K H 99.7% 85.8 26.6 13.5 80.6 0 2 0 0 2 1,768.8753 3,513.62 32,124.7 301 316 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% SFQPDTGRIEVFR R S 99.7% 27.6 26.3 18.4 25.4 0 0 2 0 2 1,551.7915 2,911.66 91,373.5 386 398 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% SGEGMGIR R L 99.0% 59.9 25.0 23.4 35.4 0 1 0 0 2 806.3826 1,284.37 16,738.6 399 406 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% SSSAPVASPNVR R R 99.7% 47.8 25.0 26.6 41.7 0 2 0 0 2 1,171.6064 1,462.27 82,964.2 19 30 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% SVVEFLQGYIGIPHGGFPEPFR R S 99.7% 78.6 27.7 13.2 78.2 0 3 6 0 2 2,446.2556 4,921.81 119312 943 964 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% TKYSLEYYMGLAEELVR R A 99.7% 43.3 27.3 0.000 43.3 0 0 7 0 2 2,081.0261 5,057.23 96,345.2 716 732 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% TVAVYSEQDTGQMHR R Q 99.7% 52.4 25.0 13.4 52.4 0 2 1 0 2 1,737.7862 1,544.40 30,016.1 63 77 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VAKENGVDAVHPGYGFLSER K A 99.7% 28.9 27.8 0.000 28.4 0 0 2 0 2 2,146.0565 2,870.93 26,232.3 105 124 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VFDYSEYWEGAR R G 99.7% 97.6 25.0 0.000 92.0 0 2 0 0 2 1,521.6644 3,548.74 31,048.8 831 842 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VIAHGKDHPTAATK K M 99.7% 39.2 26.2 0.000 25.9 0 0 2 0 2 1,445.7861 752.835 10,353.7 429 442 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VMVANRGEIAIR K V 95.6% 18.5 25.8 15.3 9.78 0 0 1 0 2 1,344.7417 2,007.50 22,997.4 40 51 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VVEIAPATHLDPQLR K S 99.7% 55.4 25.0 13.6 55.2 0 2 4 0 2 1,658.9226 2,888.88 607815 274 288 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% VVHSYEELEENYTR R A 99.7% 86.7 25.0 13.5 79.4 0 2 4 0 2 1,767.8183 2,560.36 186388 206 219 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 53 83 204 0.815% 53.5% YSLEYYMGLAEELVR K A 99.7% 74.4 26.9 17.2 60.6 0 4 5 0 2 1,835.8884 4,699.44 66,364.0 718 732 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 2 2 6 0.0240% 4.34% EAECVEADSGR R L 99.7% 42.7 25.0 13.3 42.7 0 2 0 0 2 1,222.5005 1,016.28 8,192.00 182 192 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 2 2 6 0.0240% 4.34% LALDIEIATYR K R 99.7% 62.8 25.0 0.000 58.5 0 4 0 0 2 1,277.7101 3,849.67 99,608.1 414 424 Empty true Q6NXH9 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% AKDINQEVYNFLATAGAK R Y 99.7% 33.8 27.2 13.0 28.2 0 0 2 0 2 1,953.0077 4,111.49 28,268.5 143 160 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% DINQEVYNFLATAGAK K Y 99.7% 41.4 26.3 15.3 41.3 0 0 3 0 2 1,753.8756 4,752.07 17,641.0 145 160 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% FKLEAPDADELPR K S 99.7% 50.1 26.0 15.2 43.1 0 0 2 0 2 1,500.7695 3,051.08 66,766.0 522 534 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% NAVTQEFGPVPDTAR R Y 99.7% 72.6 26.4 15.5 58.1 0 2 0 0 2 1,601.7919 2,761.48 18,101.0 634 648 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% SQFTITPGSEQIR K A 95.7% 36.2 26.6 17.0 27.3 0 2 0 0 2 1,463.7490 2,685.13 24,414.8 412 424 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% VAGILTVK K G 95.5% 26.8 25.0 16.4 0.580 0 1 0 0 2 800.5241 2,359.64 18,416.0 251 258 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% VAMSHFEPSEYIR K Y 99.7% 31.7 25.0 15.0 28.7 0 0 2 0 2 1,581.7366 2,624.73 45,876.3 32 44 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 8 8 17 0.0679% 12.2% WVVIGDENYGEGSSR R E 99.7% 60.8 25.0 0.000 58.7 0 3 0 0 2 1,667.7660 3,062.13 23,234.0 657 671 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Peroxiredoxin-1 OS=Mus musculus OX=10090 GN=Prdx1 PE=1 SV=1 P35700 Prdx1 uniprot_Mus-musculus_SP.fasta 22,177.5 90.0% 1 1 1 0.00400% 5.03% LVQAFQFTDK R H 96.6% 37.3 25.0 0.000 37.3 0 1 0 0 2 1,196.6311 3,036.38 13,530.9 159 168 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.8% 1 1 1 0.00400% 7.04% ASLENSLEETKGR K Y 99.7% 29.5 27.2 14.0 25.1 0 0 1 0 2 1,433.7231 1,997.13 38,110.0 351 363 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.8% 1 1 1 0.00400% 7.04% TRLEQEIATYR K R 99.7% 63.9 26.1 14.4 61.1 0 2 1 0 2 1,379.7278 2,577.68 49,466.1 404 414 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.8% 1 1 1 0.00400% 7.04% VTMQNLNDR K L 99.7% 79.5 25.0 23.6 0.000 0 6 0 0 2 1,106.5260 1,051.05 230319 115 123 Empty false P02535,Q61781 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% DEGANAFFK K G 98.9% 33.4 25.0 15.5 32.3 0 1 0 0 2 998.4578 2,633.94 17,862.2 264 272 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% DFLAGGIAAAVSK K T 99.7% 70.7 25.4 16.9 49.0 0 2 0 0 2 1,219.6682 3,613.64 54,290.0 11 23 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% EFNGLGDCLTK R I 95.8% 32.5 25.0 13.2 31.7 0 1 0 0 2 1,254.5673 2,746.89 14,232.3 153 163 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% EQGFLSFWR K G 97.6% 29.3 25.0 13.0 27.7 0 1 0 0 2 1,169.5738 4,243.97 26,608.9 64 72 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% GAWSNVLR K G 99.0% 40.4 27.4 32.3 12.7 0 1 0 0 2 902.4842 2,796.26 31,960.9 273 280 Empty true P51881 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% GDQALSFLK M D 99.7% 61.6 25.0 17.0 35.5 0 2 0 0 1 1,020.5362 3,838.31 22,260.1 2 10 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% GDQALSFLKDFLAGGIAAAVSK M T 99.7% 58.1 25.6 13.9 54.5 0 0 3 0 1 2,221.1866 6,370.68 7,682.70 2 23 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% GMGGAFVLVLYDEIKK R Y 99.7% 48.0 26.1 16.1 46.2 0 0 3 0 2 1,755.9353 4,412.19 68,504.9 281 296 Empty true P51881 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 9 9 15 0.0599% 28.5% LLLQVQHASK K Q 98.4% 31.2 25.0 19.9 25.2 0 1 0 0 2 1,136.6787 2,021.91 23,857.5 34 43 Empty true P51881 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Peroxiredoxin-6 OS=Mus musculus OX=10090 GN=Prdx6 PE=1 SV=3 O08709 Prdx6 uniprot_Mus-musculus_SP.fasta 24,871.7 99.1% 1 1 3 0.0120% 7.59% FHDFLGDSWGILFSHPR R D 99.7% 32.4 27.2 13.5 26.4 0 0 3 0 2 2,030.9873 4,588.43 37,681.0 25 41 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 87.7% 1 1 1 0.00400% 5.98% GVGIISEGNETVEDIAAR K L 99.7% 78.6 27.0 19.5 75.3 0 2 0 0 2 1,829.9241 3,424.92 26,254.3 627 644 Empty false Q6PIC6,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 87.7% 1 1 1 0.00400% 5.98% LNIPVSQVNPR R E 99.7% 54.1 25.0 21.4 48.5 0 2 0 0 2 1,236.7059 2,591.57 36,137.6 645 655 Empty false Q6PIC6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 87.7% 1 1 1 0.00400% 5.98% LSLDELGR K K 95.8% 28.3 26.2 26.4 15.6 0 1 0 0 2 902.4943 2,854.89 11,691.1 44 51 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 87.7% 1 1 1 0.00400% 5.98% NMVPQQALVIR K E 96.2% 29.0 25.0 17.5 18.1 0 1 0 0 2 1,284.7094 2,500.97 20,186.2 161 171 Empty false Q6PIC6,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 87.7% 1 1 1 0.00400% 5.98% VIMVTGDHPITAK K A 99.7% 37.7 25.0 19.8 36.0 0 0 1 0 2 1,397.7460 1,941.61 28,487.1 610 622 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% AQAVHPGYGFLSENK R E 99.7% 44.5 26.7 17.8 35.8 0 0 2 0 2 1,617.8020 2,542.15 53,601.9 132 146 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% AQAVHPGYGFLSENKEFAK R R 99.7% 47.8 27.8 0.000 46.9 0 0 2 0 2 2,093.0451 2,813.10 55,923.7 132 150 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% EAGGNMSIQFLGTVYK R V 99.7% 107 26.2 18.5 102 0 3 0 0 2 1,714.8470 3,528.18 31,140.1 616 631 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% FLSDVYPDGFK K G 99.7% 60.5 25.0 19.8 50.2 0 4 0 0 2 1,287.6257 3,301.44 699400 499 509 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% FSSQEAASSFGDDR R L 99.7% 110 25.0 13.7 110 0 4 0 0 2 1,503.6346 2,285.29 48,957.3 240 253 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% FVKGDISTK R F 99.6% 39.1 25.0 15.7 33.3 0 1 0 0 2 994.5569 1,240.13 19,821.9 490 498 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% GHTLTLSER K N 97.0% 31.0 25.0 0.000 31.0 0 1 0 0 2 1,013.5375 1,522.36 28,044.8 510 518 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% GVTHNIPLLR R E 99.6% 41.4 25.0 13.2 20.8 0 2 0 0 2 1,119.6634 2,560.20 238819 473 482 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% HGNALWLNER K E 99.7% 55.3 25.0 13.1 55.3 0 2 1 0 2 1,209.6123 2,407.34 50,024.5 275 284 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% HIEIQVLGDK R H 99.7% 56.4 25.0 20.2 45.1 0 4 0 0 2 1,151.6421 2,555.03 100974 265 274 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% HKQEDIPISGWAVECR R V 99.7% 40.0 27.2 0.000 38.6 0 0 2 0 2 1,924.9336 2,825.81 70,122.3 380 395 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% IAWDDEETR R D 98.8% 42.1 25.0 0.000 40.7 0 1 0 0 2 1,134.5063 2,202.14 74,191.9 227 235 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% IAWDDEETRDGFR R F 99.5% 25.5 25.0 14.5 22.1 0 0 2 0 2 1,609.7243 2,668.55 90,209.5 227 239 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% LHDEDHTVVASNNGPAFTVEVDGSK K L 99.7% 101 26.5 13.0 13.1 0 0 9 0 2 2,639.2222 2,793.32 77,318.8 561 585 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% LNVTSTWNLASPLLSVNVDGTQR K T 95.9% 20.6 26.9 13.2 14.0 0 0 1 0 2 2,485.3046 4,548.07 41,885.6 586 608 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% LQVEHPVTECITGLDLVQEMILVAK R G 99.7% 48.5 26.0 13.1 46.4 0 0 5 0 2 2,835.4999 5,179.26 38,246.0 350 374 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% LSQYQEPIHLPGVR R V 99.7% 58.8 25.5 19.2 53.4 0 2 5 0 2 1,636.8807 3,026.68 1015880 413 426 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% LVTYGSDR K A 96.3% 27.2 25.0 13.4 27.2 0 1 0 0 2 910.4629 1,447.56 54,855.0 448 455 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% MADEAVCVGPAPTSK K S 99.7% 85.9 25.0 13.6 79.8 0 2 0 0 2 1,548.7034 1,849.76 23,664.6 101 115 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% MEDALDNYVIR R G 99.7% 78.8 25.0 15.8 73.2 0 5 0 0 2 1,354.6309 2,954.12 73,714.0 462 472 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% NFYFLEMNTR K L 99.7% 45.7 25.0 16.5 40.5 0 5 0 0 2 1,334.6197 3,540.85 165667 340 349 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% NQLLAIASSVFVASQLR R A 99.7% 117 25.0 16.9 114 0 7 20 0 2 1,817.0279 5,417.96 183452 519 535 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% QAMGEQAVALAK R A 99.7% 94.3 26.8 24.7 75.6 0 4 0 0 2 1,232.6305 1,950.89 142586 310 321 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% QEDIPISGWAVECR K V 99.7% 51.7 25.1 15.8 44.4 0 2 0 0 2 1,659.7797 3,430.37 15,409.6 382 395 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% RMEDALDNYVIR K G 99.7% 44.8 26.2 17.9 38.8 0 0 2 0 2 1,494.7370 3,021.77 29,578.7 461 472 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% SFGLPSIGR K L 99.6% 42.1 25.3 15.4 38.6 0 1 0 0 2 933.5153 3,215.56 165398 404 412 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% SYLNMDAIMEAIK K K 99.7% 47.8 25.0 13.3 47.8 0 2 0 0 2 1,530.7180 3,142.33 15,338.6 116 128 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% SYLNMDAIMEAIKK K T 97.6% 22.3 26.2 16.2 19.3 0 0 1 0 2 1,626.8231 4,233.75 11,842.2 116 129 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% TVAIHSDVDASSVHVK K M 99.7% 69.5 27.5 14.2 68.8 0 0 2 0 2 1,664.8602 1,929.89 74,536.4 85 100 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% VNTIPGFDGVVK K D 97.6% 31.6 26.2 21.0 29.4 0 1 0 0 2 1,245.6839 3,131.00 62,514.5 185 196 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% VPVIRPDVAK R W 99.7% 48.8 25.0 13.6 40.7 0 2 0 0 2 1,093.6729 1,928.71 55,844.3 545 554 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% VVEEAPSIFLDPETR K Q 99.7% 82.7 27.3 15.3 82.4 0 4 1 0 2 1,701.8695 3,614.95 71,563.5 295 309 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% VYAEDPYKSFGLPSIGR R L 99.7% 54.1 27.1 15.5 49.7 0 0 2 0 2 1,898.9648 3,511.92 31,364.7 396 412 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 34 51 125 0.500% 54.8% YSSAGTVEFLVDSQK K N 99.7% 116 25.7 19.6 104 0 6 2 0 2 1,630.7959 3,403.72 171531 325 339 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0120% 4.88% AQYEDIAQK K S 99.7% 59.0 25.0 22.0 44.1 0 3 0 0 2 1,065.5212 1,614.46 111089 343 351 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0120% 4.88% KLLEGEECR R L 99.7% 50.0 25.8 13.9 47.9 0 1 0 0 2 1,133.5621 1,336.38 11,701.9 471 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0120% 4.88% LALDVEIATYR K K 99.7% 71.3 25.2 18.5 37.3 0 3 0 0 2 1,263.6944 3,548.95 95,902.0 460 470 Empty false Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.1% 1 1 3 0.0120% 4.88% LLEGEECR K L 99.0% 52.7 25.0 25.1 39.8 0 2 0 0 2 1,005.4671 1,433.09 58,367.0 472 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00799% 9.70% EVATNSELVQSGK R S 99.7% 86.5 26.6 16.8 82.0 0 2 0 0 2 1,361.6907 1,634.71 17,405.3 285 297 Empty false Q61781 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00799% 9.70% LASYLDKVR R A 99.7% 48.1 25.0 13.2 25.9 0 2 0 0 2 1,064.6099 2,175.72 78,479.5 95 103 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00799% 9.70% TRLEQEIATYR K R 99.7% 63.9 26.1 14.4 61.1 0 2 1 0 2 1,379.7278 2,577.68 49,466.1 375 385 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00799% 9.70% VLDELTLAR R A 99.7% 56.2 25.6 19.3 43.2 0 2 0 0 2 1,029.5940 2,892.06 61,348.8 193 201 Empty false Q61781,Q6IFX2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% GRLDSELR R N 95.2% 27.5 26.1 26.7 11.7 0 2 0 0 2 945.5113 1,519.79 114074 222 229 Empty false Q922U2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% KLLEGEECR R L 99.7% 50.0 25.8 13.9 47.9 0 1 0 0 2 1,133.5621 1,336.38 11,701.9 456 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% LALDVEIATYR K K 99.7% 71.3 25.2 18.5 37.3 0 3 0 0 2 1,263.6944 3,548.95 95,902.0 445 455 Empty false Q3UV17,Q922U2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% LLEGEECR K L 99.0% 52.7 25.0 25.1 39.8 0 2 0 0 2 1,005.4671 1,433.09 58,367.0 457 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% QEIAEINR K M 99.0% 35.0 25.0 18.6 14.2 0 1 0 0 2 972.5109 1,661.35 15,568.5 368 375 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% SLDLDSIIAEVK R A 99.7% 108 25.8 23.5 93.2 0 4 0 0 2 1,302.7153 4,398.16 74,238.6 316 327 Empty false Q922U2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% SRAEAESWYQTK R Y 99.7% 30.1 25.0 13.8 29.4 0 1 1 0 2 1,455.6862 1,940.38 26,686.7 337 348 Empty true Q8VED5 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 100.0% 3 4 5 0.0200% 12.7% YEELQVTAGR K H 99.7% 62.1 25.4 20.6 50.8 0 2 0 0 2 1,165.5848 2,114.80 50,970.1 349 358 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2 P56564 Slc1a3 uniprot_Mus-musculus_SP.fasta 59,624.2 99.9% 1 2 4 0.0160% 2.76% IVQVTAADAFLDLIR K N 99.7% 69.0 25.0 20.1 64.0 0 2 2 0 2 1,644.9321 4,990.24 25,303.6 161 175 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Histone H2A type 2-C OS=Mus musculus OX=10090 GN=Hist2h2ac PE=1 SV=3 Q64523,Q6GSS7 Hist2h2aa1,Hist2h2ac uniprot_Mus-musculus_SP.fasta 14,096.0 99.4% 1 1 3 0.0120% 22.5% VGAGAPVYMAAVLEYLTAEILELAGNAAR R D 99.7% 62.3 26.6 14.3 55.7 0 0 3 0 2 2,933.5442 6,643.54 10,004.0 44 72 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 96.2% 1 1 1 0.00400% 2.43% FKDIFQEIFDK R H 94.6% 19.8 25.8 19.1 14.4 0 0 1 0 2 1,429.7364 4,430.49 7,554.40 262 272 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 6 0.0240% 6.87% EAYPGDVFYLHSR R L 99.6% 56.3 25.8 0.000 56.3 0 2 0 0 2 1,553.7383 3,078.27 14,828.8 335 347 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 6 0.0240% 6.87% GIRPAINVGLSVSR K V 99.7% 40.6 25.0 0.000 40.6 0 0 2 0 2 1,438.8489 2,811.10 28,625.1 403 416 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 6 0.0240% 6.87% HALIIYDDLSK K Q 99.7% 62.2 26.8 13.0 59.8 0 2 0 0 2 1,287.6945 2,893.06 33,807.5 306 316 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 96.7% 1 1 1 0.00400% 6.67% THLPGFVEQAGALK K A 98.2% 22.5 25.0 13.0 14.6 0 0 1 0 2 1,467.7956 2,975.13 12,533.8 99 112 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Histone H2A type 1-B OS=Mus musculus OX=10090 GN=Hist1h2ab PE=1 SV=1 C0HKE1,C0HKE2,C0HKE3,C0HKE4,C0HKE5,C0HKE6,C0HKE7,C0HKE8,C0HKE9,Q8BFU2,Q8CGP5,Q8CGP6,Q8CGP7,Q8R1M2 H2afj,Hist1h2ab,Hist1h2ac,Hist1h2ad,Hist1h2ae,Hist1h2af,Hist1h2ag,Hist1h2ah,Hist1h2ai,Hist1h2ak,Hist1h2an,Hist1h2ao,Hist1h2ap,Hist3h2a uniprot_Mus-musculus_SP.fasta 14,150.1 99.1% 1 1 2 0.00799% 22.3% VGAGAPVYLAAVLEYLTAEILELAGNAAR R D 99.7% 63.0 25.0 0.000 55.0 0 0 2 0 2 2,915.5878 6,674.05 6,940.70 44 72 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 2 2 3 0.0120% 7.24% ATSASSHLNK M G 99.1% 39.2 25.0 16.7 37.1 0 2 0 0 1 1,057.5272 1,211.09 34,919.5 2 11 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 2 2 3 0.0120% 7.24% RPSANCDPYAVTEAIVR R T 97.6% 21.1 27.3 13.6 18.0 0 0 1 0 2 1,918.9440 2,979.11 13,946.0 341 357 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Q9Z2W8-DECOY Q9Z2W8-DECOY 0.0 99.1% 1 1 1 0.00400% 0.000% GVSVIQELINQLR ? ? 95.5% 19.6 25.0 21.7 12.1 0 0 1 0 2 1,469.8324 5,189.58 5,343.60 0 0 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Rab GDP dissociation inhibitor alpha OS=Mus musculus OX=10090 GN=Gdi1 PE=1 SV=3 P50396 Gdi1 uniprot_Mus-musculus_SP.fasta 50,523.1 96.0% 1 1 1 0.00400% 4.47% KFDLGQDVIDFTGHALALYR R T 98.7% 29.0 27.8 13.4 29.0 0 0 1 0 2 2,279.1822 4,997.43 5,848.60 174 193 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 2 2 3 0.0120% 6.47% LFVSGACDASAK R L 99.7% 41.7 25.0 0.000 31.0 0 1 0 0 2 1,225.5882 2,026.10 11,842.2 198 209 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 2 2 3 0.0120% 6.47% LLVSASQDGK R L 99.6% 39.6 26.5 21.5 36.6 0 2 0 0 2 1,017.5576 1,621.44 33,841.7 69 78 Empty true P62880 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Heat shock protein HSP 90-beta OS=Mus musculus OX=10090 GN=Hsp90ab1 PE=1 SV=3 P11499 Hsp90ab1 uniprot_Mus-musculus_SP.fasta 83,284.3 99.9% 1 1 1 0.00400% 3.73% DLVVLLFETALLSSGFSLEDPQTHSNR K I 99.7% 62.9 28.1 14.9 62.9 0 0 1 0 2 2,988.5315 6,420.21 1,918.40 653 679 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% DQEGQDVLLFIDNIFR R F 99.4% 50.0 26.9 13.4 49.7 0 1 0 0 2 1,921.9657 5,934.11 2,271.50 295 310 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% FTQAGSEVSALLGR R I 99.7% 81.4 26.2 13.0 77.9 0 2 0 0 2 1,435.7540 3,483.61 30,986.9 311 324 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% IGLFGGAGVGK K T 99.6% 41.6 25.0 25.6 30.5 0 2 0 0 2 975.5624 2,995.06 29,293.1 202 212 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% SLQDIIAILGMDELSEEDKLTVSR K A 99.7% 38.1 28.0 14.7 32.0 0 0 2 0 2 2,675.3812 5,401.00 5,577.80 433 456 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% TVLIMELINNVAK K A 99.7% 50.6 25.0 0.000 46.2 0 2 0 0 2 1,457.8397 5,011.71 10,859.7 213 225 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 6 6 10 0.0400% 16.6% VVDLLAPYAK K G 97.4% 39.0 25.0 17.2 29.9 0 1 0 0 2 1,088.6351 3,327.95 26,737.1 189 198 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 98.4% 1 1 1 0.00400% 2.31% AILAELTGR R R 99.5% 40.7 25.0 18.6 30.3 0 1 0 0 2 943.5572 3,058.39 14,820.3 133 141 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Annexin A2 OS=Mus musculus OX=10090 GN=Anxa2 PE=1 SV=2 P07356 Anxa2 uniprot_Mus-musculus_SP.fasta 38,678.1 99.1% 1 1 1 0.00400% 4.72% SALSGHLETVILGLLK K T 99.7% 27.7 25.0 0.000 27.7 0 0 1 0 2 1,650.9791 5,064.51 7,624.80 89 104 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 2 2 2 0.00799% 3.96% IQEVDAQMLR R D 99.7% 46.2 26.0 24.6 40.0 0 1 0 0 2 1,218.6149 2,014.91 15,205.8 433 442 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 2 2 2 0.00799% 3.96% TDLTDYLNR R H 99.6% 38.3 25.0 13.7 26.7 0 1 0 0 2 1,110.5427 2,960.57 13,666.1 214 222 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 7 14 0.0560% 12.4% ADLEMQIESLKEELAYLK R K 97.5% 23.0 27.8 14.5 22.9 0 0 1 0 2 2,139.0893 4,836.65 9,206.20 239 256 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 7 14 0.0560% 12.4% EVATNSELVQSGK R S 99.7% 86.5 26.6 16.8 82.0 0 2 0 0 2 1,361.6907 1,634.71 17,405.3 322 334 Empty true Q9QWL7 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 7 14 0.0560% 12.4% TRLEQEIATYR K R 99.7% 63.9 26.1 14.4 61.1 0 2 1 0 2 1,379.7278 2,577.68 49,466.1 412 422 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 7 14 0.0560% 12.4% VLDELTLAR R A 99.7% 56.2 25.6 19.3 43.2 0 2 0 0 2 1,029.5940 2,892.06 61,348.8 230 238 Empty true Q9QWL7,Q6IFX2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 7 14 0.0560% 12.4% VTMQNLNDR K L 99.7% 79.5 25.0 23.6 0.000 0 6 0 0 2 1,106.5260 1,051.05 230319 123 131 Empty true Q9Z2K1,P02535 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 1 1 2 0.00799% 7.08% ALEEANADLEVK R I 99.7% 79.6 26.5 32.1 18.2 0 2 0 0 2 1,301.6584 2,270.93 107539 114 125 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 1 1 2 0.00799% 7.08% TRLEQEIATYR K R 99.7% 63.9 26.1 14.4 61.1 0 2 1 0 2 1,379.7278 2,577.68 49,466.1 385 395 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 1 1 2 0.00799% 7.08% VLDELTLAR R A 99.7% 56.2 25.6 19.3 43.2 0 2 0 0 2 1,029.5940 2,892.06 61,348.8 203 211 Empty false Q9QWL7,Q61781 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% DVAGDASESALLK R C 99.7% 75.3 26.4 22.3 64.5 0 2 0 0 2 1,275.6428 2,505.59 31,600.1 436 448 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% GVGIISEGNETVEDIAAR K L 99.7% 78.6 27.0 19.5 75.3 0 2 0 0 2 1,829.9241 3,424.92 26,254.3 620 637 Empty true Q6PIE5,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% LNIPVSQVNPR R D 99.7% 54.1 25.0 21.4 48.5 0 2 0 0 2 1,236.7059 2,591.57 36,137.6 638 648 Empty true Q6PIE5 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% MQVNAEEVVVGDLVEIK K G 99.7% 33.2 27.2 18.3 27.8 0 0 1 0 2 1,887.9734 4,195.17 8,908.30 168 184 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% NMVPQQALVIR K E 96.2% 29.0 25.0 17.5 18.1 0 1 0 0 2 1,284.7094 2,500.97 20,186.2 153 163 Empty true Q6PIE5,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 6 6 9 0.0360% 8.19% VIMVTGDHPITAK K A 99.7% 37.7 25.0 19.8 36.0 0 0 1 0 2 1,397.7460 1,941.61 28,487.1 603 615 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 4 0.0160% 7.33% ALGVLAQLIWSR R A 99.7% 73.8 25.0 17.6 65.4 0 1 0 0 2 1,326.7893 4,829.58 20,033.0 429 440 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 4 0.0160% 7.33% EGSSIGAIDSR R L 99.5% 37.5 25.1 17.7 20.1 0 1 0 0 2 1,091.5328 1,735.30 90,321.6 223 233 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 4 0.0160% 7.33% IVPNILLEQGK K A 99.7% 42.1 25.0 13.1 40.0 0 2 0 0 2 1,223.7360 3,206.24 49,498.6 383 393 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 5 9 0.0360% 8.22% MHDSHLSSDEPK R H 99.7% 41.3 25.0 13.5 27.5 0 0 2 0 2 1,398.5956 784.442 36,767.5 18 29 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 5 9 0.0360% 8.22% MQEDIEMTK R T 99.5% 37.7 25.0 21.5 28.0 0 2 0 0 2 1,156.4863 1,051.56 17,434.1 509 517 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 5 9 0.0360% 8.22% NDEVSSLDAFLDLIR K N 99.7% 47.4 27.1 13.3 47.4 0 1 0 0 2 1,706.8597 5,255.21 3,175.60 159 173 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 5 9 0.0360% 8.22% SELDTIDSQHR K M 99.7% 47.2 25.0 22.3 44.4 0 2 2 0 2 1,300.6129 1,776.27 100320 498 508 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0599% 3.77% FLEQQNQVLQTK R W 99.7% 79.0 26.5 21.2 65.9 0 8 0 0 2 1,475.7854 2,432.93 145297 208 219 Empty true Q6NXH9,Q6IFZ6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0599% 3.77% TNAENEFVTIK R K 99.6% 41.8 25.5 13.6 41.1 0 1 0 0 2 1,265.6372 2,558.78 27,048.3 286 296 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 3 5 15 0.0599% 3.77% TNAENEFVTIKK R D 99.7% 77.2 25.8 16.5 63.4 0 2 4 0 2 1,393.7322 2,106.94 275682 286 297 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium- and chloride-dependent GABA transporter 3 OS=Mus musculus OX=10090 GN=Slc6a11 PE=1 SV=2 P31650 Slc6a11 uniprot_Mus-musculus_SP.fasta 69,963.1 99.9% 1 1 2 0.00799% 2.55% GSETLGGGGGGAAGTR R E 99.7% 60.8 25.0 16.7 50.5 0 2 0 0 2 1,304.6192 1,170.20 8,373.70 20 35 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Superoxide dismutase [Mn], mitochondrial OS=Mus musculus OX=10090 GN=Sod2 PE=1 SV=3 P09671 Sod2 uniprot_Mus-musculus_SP.fasta 24,603.2 91.1% 1 1 1 0.00400% 6.31% GDVTTQVALQPALK K F 97.0% 34.3 25.0 14.5 17.2 0 1 0 0 2 1,440.8059 2,668.84 9,064.60 76 89 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Histone H2A.Z OS=Mus musculus OX=10090 GN=H2afz PE=1 SV=2 P0C0S6,Q3THW5 H2afv,H2afz uniprot_Mus-musculus_SP.fasta 13,509.2 99.1% 1 1 2 0.00799% 22.7% VGATAAVYSAAILEYLTAEVLELAGNASK R D 99.7% 57.3 25.9 0.000 57.3 0 0 2 0 2 2,895.5350 6,582.11 5,034.70 47 75 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Glutathione S-transferase Mu 1 OS=Mus musculus OX=10090 GN=Gstm1 PE=1 SV=2 P10649 Gstm1 uniprot_Mus-musculus_SP.fasta 25,971.9 99.9% 1 1 1 0.00400% 5.50% KHHLDGETEEER R I 99.7% 40.9 25.0 15.6 37.8 0 0 1 0 2 1,479.6824 776.962 6,695.10 83 94 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 99.9% 1 1 2 0.00799% 7.10% IQFNESFAEMNR R G 99.7% 57.0 25.0 0.000 57.0 0 2 0 0 2 1,501.6740 2,781.21 14,436.6 84 95 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% AGFAGDDAPR K A 99.7% 43.9 25.0 20.3 33.2 0 2 0 0 2 976.4484 1,514.70 54,852.3 19 28 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% DSYVGDEAQSKR K G 98.1% 35.6 25.0 13.2 32.3 0 1 0 0 2 1,354.6234 1,211.36 4,351.20 51 62 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% GYSFTTTAER R E 99.7% 47.0 25.0 13.9 46.5 0 1 0 0 2 1,132.5269 2,119.00 38,077.3 197 206 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% IWHHTFYNELR K V 99.7% 36.5 25.4 0.000 32.1 0 0 2 0 2 1,515.7491 2,652.29 40,533.7 85 95 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% QEYDESGPSIVHR K K 99.7% 35.5 25.0 0.000 34.5 0 0 2 0 2 1,516.7027 1,878.44 40,968.3 360 372 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 6 6 11 0.0440% 19.2% SYELPDGQVITIGNER K F 99.7% 74.8 27.6 14.6 64.6 0 3 0 0 2 1,790.8921 3,637.76 24,551.5 239 254 Empty true Q8BFZ3 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Polypyrimidine tract-binding protein 1 OS=Mus musculus OX=10090 GN=Ptbp1 PE=1 SV=2 P17225 Ptbp1 uniprot_Mus-musculus_SP.fasta 56,478.9 90.2% 1 1 1 0.00400% 3.42% VTPQSLFILFGVYGDVQR R V 96.7% 18.5 25.7 13.2 18.5 0 0 1 0 2 2,039.0962 5,288.82 5,329.60 347 364 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3 Q02257 Jup uniprot_Mus-musculus_SP.fasta 81,801.9 98.8% 1 1 2 0.00799% 2.42% TLVTQNSGVEALIHAILR K A 99.5% 31.7 25.0 13.3 24.2 0 0 2 0 2 1,935.1023 5,140.62 14,120.3 427 444 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Voltage-dependent anion-selective channel protein 2 OS=Mus musculus OX=10090 GN=Vdac2 PE=1 SV=2 Q60930 Vdac2 uniprot_Mus-musculus_SP.fasta 31,733.6 99.8% 1 1 1 0.00400% 4.75% LTFDTTFSPNTGKK K S 99.7% 27.9 25.5 14.0 24.8 0 0 1 0 2 1,556.7957 2,753.15 17,327.7 109 122 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Hadha PE=1 SV=1 Q8BMS1 Hadha uniprot_Mus-musculus_SP.fasta 82,671.5 99.1% 1 1 2 0.00799% 2.10% LPAKPEVSSDEDVQYR R V 99.7% 45.9 27.2 15.0 38.3 0 0 2 0 2 1,832.9026 2,075.95 34,369.7 661 676 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 7 0.0280% 4.95% DYQELMNTK R L 99.7% 47.9 25.0 13.2 26.9 0 4 0 0 2 1,157.5145 2,013.84 97,138.8 483 491 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 7 0.0280% 4.95% GFSSGSAVVSGGSR R R 99.7% 106 25.0 19.5 92.7 0 2 0 0 2 1,254.6072 1,778.49 93,642.6 23 36 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 7 0.0280% 4.95% KLLEGEECR R M 99.7% 50.0 25.8 13.9 47.9 0 1 0 0 2 1,133.5621 1,336.38 11,701.9 503 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 7 0.0280% 4.95% LLEGEECR K M 99.0% 52.7 25.0 25.1 39.8 0 2 0 0 2 1,005.4671 1,433.09 58,367.0 504 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 7 0.0280% 4.95% LLRDYQELMNTK R L 98.6% 22.4 26.1 13.3 10.8 0 0 1 0 2 1,523.7888 2,898.54 22,674.7 480 491 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 2 3 4 0.0160% 6.03% FGVEQDVDMVFASFIR K K 99.7% 98.8 26.5 13.1 97.5 0 2 1 0 2 1,859.8997 5,539.47 11,597.8 231 246 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Pyruvate kinase PKM OS=Mus musculus OX=10090 GN=Pkm PE=1 SV=4 P52480 Pkm uniprot_Mus-musculus_SP.fasta 57,845.6 100.0% 2 3 4 0.0160% 6.03% RFDEILEASDGIMVAR R G 97.6% 28.8 27.3 18.1 26.0 0 0 1 0 2 1,821.9165 3,725.43 10,847.3 279 294 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% DGSYDMQIDNK R S 99.6% 46.8 25.0 0.000 42.0 0 2 0 0 2 1,301.5317 1,447.31 11,182.6 567 577 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% DLLPSHSTIAK K E 99.7% 53.2 25.0 19.4 41.3 0 2 0 0 2 1,181.6526 2,113.55 93,474.6 491 501 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% EFQEQLESAR R R 98.9% 42.2 25.0 26.8 33.9 0 2 0 0 2 1,236.5855 2,127.28 43,530.7 219 228 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% ESVCQAALGLILK K E 99.7% 96.5 25.6 17.0 88.1 0 2 0 0 2 1,401.7772 4,472.91 49,694.2 502 514 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% HAPLVEFEEEESDK R - 99.7% 46.7 25.0 0.000 46.7 0 2 1 0 2 1,658.7545 2,586.53 31,014.2 704 717 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% IIEEAPAPGINPEVR K R 99.7% 60.9 26.3 14.2 60.6 0 2 0 0 2 1,604.8644 2,631.24 21,832.3 281 295 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% IPLSQEEIPLQGHAFEAR K I 99.7% 67.9 27.2 13.4 66.3 0 0 2 0 2 2,035.0609 3,225.32 89,555.0 364 381 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% LHTQDQFSPFSFSSGR K R 99.7% 82.5 25.1 0.000 82.5 0 2 0 0 2 1,840.8613 3,296.24 12,987.4 524 539 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% LQVEHPVTEMITGTDLVEWQLR R I 98.6% 24.0 27.7 14.4 21.3 0 0 1 0 2 2,594.3286 4,393.37 11,679.1 336 357 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% LVVWASDR K Q 99.0% 42.3 27.9 19.6 29.3 0 2 0 0 2 945.5152 2,543.39 58,742.9 433 440 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% MGVQSVAVYSEADR K N 99.7% 55.5 25.0 17.4 47.9 0 1 0 0 2 1,527.7108 2,312.87 5,153.40 67 80 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% RLNISYTR R N 99.0% 36.4 25.0 15.8 31.4 0 1 0 0 2 1,022.5741 1,845.18 66,725.3 540 547 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% SDIVIAVTYNR K D 99.7% 66.4 25.0 14.8 57.5 0 3 0 0 2 1,250.6739 2,901.79 56,417.0 556 566 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% SIMAAAGVPVVEGYHGK K D 98.5% 24.0 27.2 13.0 19.6 0 0 1 0 2 1,701.8630 2,500.53 24,337.9 164 180 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% SNVDFLLR R L 99.0% 62.2 25.0 40.4 42.8 0 2 0 0 2 963.5258 3,249.58 36,877.6 461 468 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% VFFSEGAQANR K H 99.7% 62.4 25.0 18.4 56.3 0 2 0 0 2 1,225.5959 2,285.43 37,189.3 693 703 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% VLGDLSSEDGCTYLK R S 99.7% 78.3 25.4 0.000 78.3 0 4 0 0 2 1,656.7788 2,965.99 26,169.6 581 595 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% YCLHQYNIVGLR R S 99.7% 41.0 26.8 0.000 41.0 0 3 2 0 2 1,535.7788 3,013.37 137417 449 460 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% YLSPVSAEGAQGGTIAPMTGTIEK K V 99.7% 31.5 28.0 16.2 31.5 0 0 2 0 2 2,394.1861 2,839.20 25,039.6 632 655 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 20 23 46 0.184% 37.9% YVGAGTVEFIMDSR K H 99.7% 64.4 25.4 15.8 64.4 0 5 0 0 2 1,560.7364 3,220.13 74,835.2 311 324 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% AYNMLDIIHAVIDER K E 99.7% 32.6 27.2 16.8 27.7 0 0 2 0 2 1,772.9001 5,169.76 13,668.7 315 329 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% DTSYLFITGPEVVK K S 99.7% 53.3 25.9 16.9 49.8 0 2 0 0 2 1,568.8208 3,849.63 33,497.0 221 234 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% FANPFPAAVR K G 95.8% 28.3 26.6 13.1 19.0 0 1 0 0 2 1,089.5839 3,138.91 22,092.6 492 501 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% GAVEIIFK K G 99.0% 46.6 25.0 22.1 16.7 0 2 0 0 2 876.5190 3,094.02 29,757.1 469 476 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% IQEGVESLAGYADIFLR R N 99.7% 30.7 26.6 0.000 30.7 0 0 2 0 2 1,880.9754 4,871.36 12,624.6 168 184 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% LVPELDTVVPLESSK R A 99.7% 55.7 25.0 13.8 55.7 0 2 0 0 2 1,625.8998 3,667.86 31,990.7 300 314 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% LVYVFSQDFTVFGGSLSGAHAQK R I 96.3% 22.1 28.1 13.7 20.1 0 0 1 0 2 2,458.2402 4,365.67 14,086.0 120 142 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% NIVVGFAR K M 97.7% 32.5 25.0 18.1 32.5 0 1 0 0 2 875.5097 2,674.33 20,770.0 341 348 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 9 9 15 0.0599% 23.3% SVTNEDVTQEQLGGAK K T 99.7% 93.9 26.8 17.9 83.1 0 2 0 0 2 1,675.8135 1,977.26 12,869.1 235 250 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 41.3% 0 0 0 0.000% 11.4% GAWSNVLR K G 99.0% 40.4 27.4 32.3 12.7 0 1 0 0 2 902.4842 2,796.26 31,960.9 273 280 Empty false P48962 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 41.3% 0 0 0 0.000% 11.4% GMGGAFVLVLYDEIKK R Y 99.7% 48.0 26.1 16.1 46.2 0 0 3 0 2 1,755.9353 4,412.19 68,504.9 281 296 Empty false P48962 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 41.3% 0 0 0 0.000% 11.4% LLLQVQHASK K Q 98.4% 31.2 25.0 19.9 25.2 0 1 0 0 2 1,136.6787 2,021.91 23,857.5 34 43 Empty false P48962 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 2 3 4 0.0160% 8.53% SGETEDTFIADLVVGLCTGQIK R T 99.7% 35.4 27.9 13.6 33.6 0 1 1 0 2 2,353.1596 5,378.00 3,762.10 373 394 Empty true P17183 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Alpha-enolase OS=Mus musculus OX=10090 GN=Eno1 PE=1 SV=3 P17182 Eno1 uniprot_Mus-musculus_SP.fasta 47,141.7 100.0% 2 3 4 0.0160% 8.53% VNQIGSVTESLQACK K L 99.7% 75.8 26.9 13.3 0.000 0 2 0 0 2 1,633.8215 2,730.15 6,901.40 344 358 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 100.0% 1 1 1 0.00400% 1.93% YGLAAAVFTK K D 99.7% 46.5 25.0 17.2 45.8 0 1 0 0 2 1,040.5775 3,163.92 16,526.2 444 453 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Phosphoglycerate kinase 1 OS=Mus musculus OX=10090 GN=Pgk1 PE=1 SV=4 P09411 Pgk1 uniprot_Mus-musculus_SP.fasta 44,551.1 98.6% 1 1 2 0.00799% 3.60% LGDVYVNDAFGTAHR K A 99.6% 27.9 26.4 14.6 27.9 0 0 2 0 2 1,634.7922 2,873.84 30,409.3 157 171 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0120% 8.22% SYEAYVLNIIR K F 99.7% 60.8 25.0 13.8 54.7 0 2 0 0 2 1,340.7208 4,176.00 33,679.9 97 107 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 2 2 3 0.0120% 8.22% VAPPGLTQIPQIQK R T 94.9% 25.7 25.0 13.8 25.7 0 1 0 0 2 1,489.8740 3,103.64 14,858.6 72 85 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 1 1 2 0.00799% 5.71% SVTEQGAELSNEER K N 99.7% 94.1 25.0 0.000 93.1 0 2 0 0 2 1,548.7136 1,788.11 10,649.9 28 41 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Protein S100-A6 OS=Mus musculus OX=10090 GN=S100a6 PE=1 SV=3 P14069 S100a6 uniprot_Mus-musculus_SP.fasta 10,051.4 99.1% 1 1 2 0.00799% 19.1% ACPLDQAIGLLVAIFHK M Y 99.7% 68.5 25.0 13.5 68.5 0 2 0 0 1 1,908.0415 6,575.31 10,373.1 2 18 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 96.2% 1 1 1 0.00400% 7.79% FLEQQNQVLQTK R W 99.7% 79.0 26.5 21.2 65.9 0 8 0 0 2 1,475.7854 2,432.93 145297 151 162 Empty false P04104,Q6IFZ6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 96.2% 1 1 1 0.00400% 7.79% KLLEGEECR R M 99.7% 50.0 25.8 13.9 47.9 0 1 0 0 2 1,133.5621 1,336.38 11,701.9 435 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 96.2% 1 1 1 0.00400% 7.79% LALDIEIATYR K K 99.7% 62.8 25.0 0.000 58.5 0 4 0 0 2 1,277.7101 3,849.67 99,608.1 424 434 Empty false Q9Z2T6 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 96.2% 1 1 1 0.00400% 7.79% LLEGEECR K M 99.0% 52.7 25.0 25.1 39.8 0 2 0 0 2 1,005.4671 1,433.09 58,367.0 436 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 96.2% 1 1 1 0.00400% 7.79% VRAQEREQIK K A 98.1% 22.1 26.1 28.2 4.40 0 0 1 0 2 1,257.6911 798.829 8,109.60 127 136 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 4 4 8 0.0320% 11.8% GTFCSFDTPDEAIR R N 99.7% 47.7 25.0 0.000 47.7 0 1 0 0 2 1,615.7059 3,044.03 6,435.50 437 450 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 4 4 8 0.0320% 11.8% IDIPSFDWPIAPFPR K L 98.7% 36.1 26.7 13.9 35.2 0 1 0 0 2 1,770.9216 4,975.94 7,598.60 236 250 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 4 4 8 0.0320% 11.8% LKYPLEEFTTDNQQEEAR R C 99.7% 42.7 27.1 0.000 38.6 0 0 4 0 2 2,211.0566 3,180.67 42,106.0 251 268 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 4 4 8 0.0320% 11.8% NLLLAEVINIIK K R 99.7% 64.7 25.0 25.6 64.7 0 2 0 0 2 1,352.8513 5,460.26 13,488.5 389 400 Empty true 22-2895 12 12 20220411_bbm1840_22-2895_Killinger_12 (F006910) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Mus musculus OX=10090 GN=Ndufa10 PE=1 SV=1 Q99LC3 Ndufa10 uniprot_Mus-musculus_SP.fasta 40,604.7 98.3% 1 1 1 0.00400% 3.10% YGLLAAILGDK R T 99.4% 37.5 25.0 0.000 37.5 0 1 0 0 2 1,133.6567 4,646.71 7,029.00 38 48 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% AILVDLEPGTMDSVR R S 99.7% 60.6 27.0 16.5 53.2 0 2 0 0 2 1,631.8312 3,241.29 33,142.5 63 77 Empty true P99024,Q9ERD7 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% GHYTEGAELVDSVLDVVRK K E 99.7% 47.3 27.6 14.9 47.1 0 0 2 0 2 2,087.0769 4,249.08 70,314.2 104 122 Empty true P99024,Q9ERD7,Q922F4,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% LAVNMVPFPR K L 99.7% 67.2 26.7 21.8 54.2 0 2 0 0 2 1,159.6293 3,018.66 104212 253 262 Empty true P99024,Q9ERD7,Q922F4,Q9D6F9,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% MREIVHIQAGQCGNQIGAK - F 99.7% 32.8 27.5 14.7 0.000 0 0 1 0 2 2,126.0596 2,005.22 11,923.4 1 19 Empty true P99024,Q9ERD7,Q9D6F9,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% MSMKEVDEQMLNVQNK R N 99.7% 40.7 25.0 13.2 40.7 0 0 2 0 2 1,971.8822 1,637.77 49,141.0 321 336 Empty true P99024,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 46.8 28.2 13.5 39.8 0 0 5 0 2 2,798.3435 4,345.06 58,061.2 78 103 Empty true P99024,Q9D6F9,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1 Q7TMM9 Tubb2a uniprot_Mus-musculus_SP.fasta 49,907.1 100.0% 7 7 16 0.0634% 25.6% YLTVAAIFR R G 99.7% 48.6 25.0 0.000 42.4 0 2 0 0 2 1,053.6091 3,946.38 57,505.8 310 318 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 2 2 3 0.0119% 5.24% GVMLAVDAVIAELKK R Q 97.1% 25.4 25.0 13.4 21.8 0 0 2 0 2 1,572.9032 4,406.05 20,995.0 143 157 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 60 kDa heat shock protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspd1 PE=1 SV=1 P63038 Hspd1 uniprot_Mus-musculus_SP.fasta 60,956.8 100.0% 2 2 3 0.0119% 5.24% VGGTSDVEVNEKKDR K V 99.6% 31.4 27.0 18.6 20.6 0 0 1 0 2 1,632.8189 1,033.08 13,949.4 406 420 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Heat shock cognate 71 kDa protein OS=Mus musculus OX=10090 GN=Hspa8 PE=1 SV=1 P63017 Hspa8 uniprot_Mus-musculus_SP.fasta 70,872.8 99.8% 1 1 2 0.00793% 2.01% TTPSYVAFTDTER R L 97.4% 31.9 25.0 0.000 31.9 0 2 0 0 2 1,487.7013 2,777.23 20,190.8 37 49 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 5 0.0198% 6.93% ISQLYGDLK K H 99.0% 38.2 25.0 23.0 27.7 0 1 0 0 2 1,036.5675 2,485.67 33,013.0 539 547 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 5 0.0198% 6.93% LGANSLLDLVVFGR R A 99.7% 113 25.0 13.6 113 0 1 0 0 2 1,473.8425 5,147.23 14,464.6 452 465 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 5 0.0198% 6.93% TGHSLLHTLYGR R S 98.9% 24.0 25.0 14.8 16.0 0 0 1 0 2 1,354.7227 2,465.62 41,022.2 196 207 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Mus musculus OX=10090 GN=Sdha PE=1 SV=1 Q8K2B3 Sdha uniprot_Mus-musculus_SP.fasta 72,585.6 100.0% 4 4 5 0.0198% 6.93% VGSVLQEGCEK R I 99.7% 69.7 25.9 18.9 65.4 0 2 0 0 2 1,205.5832 1,676.72 35,927.0 528 538 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 3 4 11 0.0436% 15.4% GAWSNVLR K G 99.0% 54.2 27.4 30.5 16.7 0 2 0 0 2 902.4842 2,777.65 70,484.0 273 280 Empty true P51881 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 3 4 11 0.0436% 15.4% GDQALSFLKDFLAGGIAAAVSK M T 99.7% 73.6 25.2 16.1 65.5 0 1 5 0 1 2,221.1866 6,384.85 18,660.7 2 23 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 1 OS=Mus musculus OX=10090 GN=Slc25a4 PE=1 SV=4 P48962 Slc25a4 uniprot_Mus-musculus_SP.fasta 32,905.4 100.0% 3 4 11 0.0436% 15.4% GMGGAFVLVLYDEIKK R Y 99.7% 38.8 25.8 15.8 38.8 0 0 3 0 2 1,755.9353 4,396.26 106450 281 296 Empty true P51881 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 6 0.0238% 8.07% ALEESNYELEGK R I 99.7% 96.7 25.0 21.2 89.9 0 2 0 0 2 1,381.6482 2,176.15 785108 164 175 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 6 0.0238% 8.07% QSLEASLAETEGR K Y 99.7% 101 25.7 17.4 89.3 0 2 0 0 2 1,390.6809 2,685.44 52,760.3 385 397 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 6 0.0238% 8.07% QSVEADINGLRR R V 96.1% 23.0 26.5 19.2 16.4 0 0 2 0 2 1,357.7183 2,466.66 88,640.3 244 255 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3 P02535 Krt10 uniprot_Mus-musculus_SP.fasta 57,771.3 100.0% 3 4 6 0.0238% 8.07% VTMQNLNDR R L 99.7% 79.4 25.1 26.6 0.000 0 5 0 0 2 1,106.5260 1,042.01 198117 146 154 Empty false Q9Z2K1,Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 4 7 0.0278% 10.8% FCTGLTQIETLFK R S 99.7% 69.6 26.1 13.2 69.6 0 3 0 0 2 1,557.7984 4,532.14 43,957.3 253 265 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 4 7 0.0278% 10.8% LGFSEVELVQMVVDGVK R L 99.7% 56.7 26.4 13.3 52.9 0 1 1 0 2 1,848.9777 5,310.88 7,634.50 342 358 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Creatine kinase B-type OS=Mus musculus OX=10090 GN=Ckb PE=1 SV=1 Q04447 Ckb uniprot_Mus-musculus_SP.fasta 42,714.1 100.0% 3 4 7 0.0278% 10.8% VLTPELYAELR K A 99.7% 46.0 25.0 16.0 30.7 0 2 0 0 2 1,303.7257 3,479.44 66,545.2 33 43 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Hemoglobin subunit alpha OS=Mus musculus OX=10090 GN=Hba PE=1 SV=2 P01942 Hba uniprot_Mus-musculus_SP.fasta 15,085.4 99.1% 1 1 1 0.00396% 10.6% IGGHGAEYGAEALER K M 99.7% 34.9 25.0 18.4 20.6 0 0 1 0 2 1,529.7344 2,158.46 34,852.2 18 32 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 2 2 4 0.0159% 9.76% AGQVFLEELGNHK K A 99.7% 28.1 25.0 16.7 28.1 0 0 2 0 2 1,441.7435 3,011.18 52,478.0 204 216 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3 P16330 Cnp uniprot_Mus-musculus_SP.fasta 47,125.2 100.0% 2 2 4 0.0159% 9.76% AHVTLGCAADVQPVQTGLDLLDILQQVK R G 98.5% 27.7 25.1 18.8 27.3 0 0 2 0 2 3,002.5985 5,368.05 3,893.20 328 355 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 3 3 4 0.0159% 7.65% IAEFAFEYAR R N 99.7% 54.7 25.1 23.3 44.7 0 1 0 0 2 1,216.5996 3,367.51 38,941.0 179 188 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 3 3 4 0.0159% 7.65% LITEEASKR K I 96.3% 30.7 25.2 13.3 27.1 0 1 0 0 2 1,046.5841 1,137.44 16,714.9 170 178 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1 Q9D6R2 Idh3a uniprot_Mus-musculus_SP.fasta 39,639.4 100.0% 3 3 4 0.0159% 7.65% MSDGLFLQK R C 99.4% 41.7 25.0 20.6 37.0 0 2 0 0 2 1,054.5240 2,549.72 93,402.7 206 214 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 173 181 Empty true Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% LLEGEECR K L 99.0% 39.5 25.0 21.0 27.8 0 2 0 0 2 1,005.4671 1,422.31 101738 467 474 Empty true Q3TTY5,Q3UV17,Q6NXH9,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% LRSEIDNVK R K 97.3% 32.7 26.2 21.7 19.4 0 1 0 0 2 1,073.5950 1,387.23 23,824.3 390 398 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% LRSEIDNVKK R Q 99.7% 46.3 25.0 30.7 11.6 0 0 2 0 2 1,201.6900 1,114.49 217238 390 399 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% NKYEDEINKR K T 99.7% 46.8 25.1 18.0 35.5 0 1 4 0 2 1,308.6543 1,397.23 163114 250 259 Empty true Q8VED5,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% SLDLDSIIAEVK R A 99.7% 100 25.7 27.7 85.8 0 4 1 0 2 1,302.7153 4,379.83 170474 326 337 Empty true P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 168 181 Empty true Q3TTY5,Q8VED5,Q3UV17,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% VRTEEREQIK R T 95.6% 22.5 26.4 26.0 0.000 0 0 1 0 2 1,287.7016 786.920 70,447.8 158 167 Empty true Q8VED5,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1 Q922U2 Krt5 uniprot_Mus-musculus_SP.fasta 61,768.0 100.0% 9 11 20 0.0793% 12.8% YEELQQTAGR K H 99.7% 60.8 25.0 24.5 55.6 0 2 0 0 2 1,194.5750 1,551.50 33,800.3 359 368 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 99.9% 2 2 3 0.0119% 6.16% GSTASQVLQR K L 97.4% 38.8 26.1 25.8 24.8 0 1 0 0 2 1,046.5589 1,526.44 35,541.1 291 300 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1 Q8VEM8 Slc25a3 uniprot_Mus-musculus_SP.fasta 39,633.1 99.9% 2 2 3 0.0119% 6.16% IQTQPGYANTLR R E 97.6% 34.8 26.4 17.1 26.5 0 2 0 0 2 1,361.7173 2,062.97 77,492.0 185 196 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 96.8% 1 1 1 0.00396% 18.7% GHYTEGAELVDAVLDVVRK K E 99.0% 24.3 26.7 0.000 24.3 0 0 1 0 2 2,071.0820 4,627.17 16,657.5 104 122 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 96.8% 1 1 1 0.00396% 18.7% LAVNMVPFPR K L 99.7% 67.2 26.7 21.8 54.2 0 2 0 0 2 1,159.6293 3,018.66 104212 253 262 Empty false P99024,Q9ERD7,Q922F4,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 96.8% 1 1 1 0.00396% 18.7% MREIVHLQAGQCGNQIGAK - F 99.7% 32.8 27.5 14.7 0.000 0 0 1 0 2 2,126.0596 2,005.22 11,923.4 1 19 Empty false P99024,Q9ERD7,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 96.8% 1 1 1 0.00396% 18.7% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 46.8 28.2 13.5 39.8 0 0 5 0 2 2,798.3435 4,345.06 58,061.2 78 103 Empty false P99024,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4A chain OS=Mus musculus OX=10090 GN=Tubb4a PE=1 SV=3 Q9D6F9 Tubb4a uniprot_Mus-musculus_SP.fasta 49,585.5 96.8% 1 1 1 0.00396% 18.7% YLTVAAVFR R G 99.7% 61.5 25.0 0.000 61.5 0 2 0 0 2 1,039.5934 3,585.72 97,680.5 310 318 Empty false P99024,P68372 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.9% 1 2 3 0.0119% 8.66% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 150 158 Empty false Q3TTY5,P04104,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.9% 1 2 3 0.0119% 8.66% NKYEDEINKR K T 99.7% 46.8 25.1 18.0 35.5 0 1 4 0 2 1,308.6543 1,397.23 163114 228 237 Empty false Q922U2,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.9% 1 2 3 0.0119% 8.66% NLDLDSIIAEVK R A 99.7% 86.3 25.7 33.8 65.8 0 3 0 0 2 1,329.7262 4,361.19 236026 304 315 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.9% 1 2 3 0.0119% 8.66% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 145 158 Empty false Q3TTY5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 79 OS=Mus musculus OX=10090 GN=Krt79 PE=1 SV=2 Q8VED5 Krt79 uniprot_Mus-musculus_SP.fasta 57,553.3 99.9% 1 2 3 0.0119% 8.66% VRTQEREQIK R T 95.6% 22.5 26.4 26.0 0.000 0 0 1 0 2 1,287.7017 786.920 70,447.8 135 144 Empty false Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ogdh PE=1 SV=3 Q60597 Ogdh uniprot_Mus-musculus_SP.fasta 116,450.6 99.9% 1 1 1 0.00396% 0.978% NMEEEVAITR R I 99.4% 44.9 25.0 16.4 14.2 0 1 0 0 2 1,207.5624 1,772.41 11,562.3 920 929 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 2 0.00793% 8.66% IGGIGTVPVGR K V 99.7% 52.4 25.0 13.1 43.5 0 1 0 0 2 1,025.6104 2,422.47 37,497.8 256 266 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Elongation factor 1-alpha 1 OS=Mus musculus OX=10090 GN=Eef1a1 PE=1 SV=3 P10126 Eef1a1 uniprot_Mus-musculus_SP.fasta 50,114.2 100.0% 2 2 2 0.00793% 8.66% NMITGTSQADCAVLIVAAGVGEFEAGISK K N 95.6% 24.5 28.4 14.6 24.5 0 0 1 0 2 2,909.4386 5,701.59 1,601.60 101 129 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 28 OS=Mus musculus OX=10090 GN=Krt28 PE=1 SV=1 A6BLY7 Krt28 uniprot_Mus-musculus_SP.fasta 50,346.9 99.1% 1 2 4 0.0159% 1.95% VTMQNLNNR K L 99.7% 79.4 25.1 26.6 0.000 0 4 0 0 2 1,106.5259 1,043.58 176476 86 94 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 5 6 13 0.0515% 12.5% GASIVEDKLVEDLKTR R E 99.7% 51.8 25.5 0.000 48.8 0 0 1 0 2 1,772.9755 3,148.60 45,076.4 77 92 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 5 6 13 0.0515% 12.5% IIAEGANGPTTPEADKIFLER K N 99.7% 53.4 27.5 14.1 48.0 0 0 7 0 2 2,243.1558 3,243.28 207000 400 420 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 5 6 13 0.0515% 12.5% TAAYVNAIEK R V 99.7% 53.3 25.0 0.000 36.2 0 2 0 0 2 1,079.5731 2,056.92 69,295.3 536 545 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 5 6 13 0.0515% 12.5% TAMKYNLGLDLR R T 98.3% 24.4 25.3 0.000 22.0 0 0 2 0 2 1,410.7412 2,816.71 84,250.5 524 535 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamate dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Glud1 PE=1 SV=1 P26443 Glud1 uniprot_Mus-musculus_SP.fasta 61,338.4 100.0% 5 6 13 0.0515% 12.5% YSTDVSVDEVK R A 99.7% 49.2 25.0 13.5 49.2 0 1 0 0 2 1,241.5896 2,136.61 25,738.2 152 162 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% GHYTEGAELVDSVLDVVRK K E 99.7% 47.3 27.6 14.9 47.1 0 0 2 0 2 2,087.0769 4,249.08 70,314.2 104 122 Empty false P99024,Q9ERD7,Q922F4,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% LAVNMVPFPR K L 99.7% 67.2 26.7 21.8 54.2 0 2 0 0 2 1,159.6293 3,018.66 104212 253 262 Empty false P99024,Q9ERD7,Q922F4,Q9D6F9,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% MREIVHLQAGQCGNQIGAK - F 99.7% 32.8 27.5 14.7 0.000 0 0 1 0 2 2,126.0596 2,005.22 11,923.4 1 19 Empty false P99024,Q9ERD7,Q9D6F9,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% MSMKEVDEQMLNVQNK R N 99.7% 40.7 25.0 13.2 40.7 0 0 2 0 2 1,971.8822 1,637.77 49,141.0 321 336 Empty false P99024,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% SGPFGQIFRPDNFVFGQSGAGNNWAK R G 99.7% 46.8 28.2 13.5 39.8 0 0 5 0 2 2,798.3435 4,345.06 58,061.2 78 103 Empty false P99024,Q9D6F9,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-4B chain OS=Mus musculus OX=10090 GN=Tubb4b PE=1 SV=1 P68372 Tubb4b uniprot_Mus-musculus_SP.fasta 49,830.7 99.6% 1 1 2 0.00793% 22.2% YLTVAAVFR R G 99.7% 61.5 25.0 0.000 61.5 0 2 0 0 2 1,039.5934 3,585.72 97,680.5 310 318 Empty true P99024,Q9D6F9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% AVFVDLEPTVIDEVR R T 99.7% 54.4 26.3 15.7 41.5 0 2 0 0 2 1,701.9059 4,071.60 76,283.8 65 79 Empty false P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% DVNAAIATIK K T 99.1% 40.1 26.8 21.1 31.6 0 2 0 0 2 1,015.5783 2,520.53 79,990.5 327 336 Empty false P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% EIIDLVLDR K I 99.1% 43.9 25.0 24.3 39.0 0 2 0 0 2 1,085.6203 3,796.90 42,676.1 113 121 Empty false P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% GHYTIGKEIIDLVLDR R I 99.7% 54.7 25.3 13.1 44.9 0 0 4 0 2 1,842.0123 4,657.05 73,326.3 106 121 Empty false P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% IHFPLATYAPVISAEK R A 99.7% 35.6 25.5 22.4 27.3 0 0 2 0 2 1,756.9633 3,778.14 94,129.7 265 280 Empty false P68368,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% LDHKFDLMYAK R R 95.3% 20.2 25.4 0.000 20.2 0 0 1 0 2 1,396.6932 2,267.15 72,943.3 391 401 Empty false P68368,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% LIGQIVSSITASLR R F 99.7% 72.2 25.0 0.000 72.2 0 2 2 0 2 1,457.8687 4,777.40 50,603.6 230 243 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% QLFHPEQLITGK R E 99.7% 37.5 25.0 13.4 37.5 0 0 2 0 2 1,410.7742 3,145.30 44,998.0 85 96 Empty false P68368,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% QLFHPEQLITGKEDAANNYAR R G 99.7% 58.2 28.5 0.000 56.7 0 0 1 0 2 2,415.2053 3,066.64 30,233.4 85 105 Empty false P68368,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% TIQFVDWCPTGFK R V 99.7% 54.0 25.2 17.3 48.7 0 2 0 0 2 1,598.7674 4,033.22 26,960.2 340 352 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1A chain OS=Mus musculus OX=10090 GN=Tuba1a PE=1 SV=1 P68369 Tuba1a uniprot_Mus-musculus_SP.fasta 50,135.7 100.0% 2 3 6 0.0238% 29.7% VGINYQPPTVVPGGDLAK K V 97.9% 43.8 25.0 13.2 43.8 0 2 0 0 2 1,824.9857 3,218.20 60,463.3 353 370 Empty false P68368,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% DVNAAIAAIK K T 99.7% 50.4 25.0 15.2 37.3 0 2 0 0 2 985.5677 2,765.16 60,031.9 327 336 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% IHFPLATYAPVISAEK R A 99.7% 35.6 25.5 22.4 27.3 0 0 2 0 2 1,756.9633 3,778.14 94,129.7 265 280 Empty false P68369,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% LDHKFDLMYAK R R 95.3% 20.2 25.4 0.000 20.2 0 0 1 0 2 1,396.6932 2,267.15 72,943.3 391 401 Empty false P68369,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% LISQIVSSITASLR R F 99.7% 83.4 25.0 13.6 79.0 0 2 3 0 2 1,487.8792 4,935.06 44,674.5 230 243 Empty false P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% QLFHPEQLITGK R E 99.7% 37.5 25.0 13.4 37.5 0 0 2 0 2 1,410.7742 3,145.30 44,998.0 85 96 Empty false P68369,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% QLFHPEQLITGKEDAANNYAR R G 99.7% 58.2 28.5 0.000 56.7 0 0 1 0 2 2,415.2053 3,066.64 30,233.4 85 105 Empty false P68369,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-4A chain OS=Mus musculus OX=10090 GN=Tuba4a PE=1 SV=1 P68368 Tuba4a uniprot_Mus-musculus_SP.fasta 49,924.6 99.1% 1 1 2 0.00793% 20.1% VGINYQPPTVVPGGDLAK K V 97.9% 43.8 25.0 13.2 43.8 0 2 0 0 2 1,824.9857 3,218.20 60,463.3 353 370 Empty false P68369,P05213 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 99.1% 1 1 2 0.00793% 6.65% GVGIISEGNETVEDIAAR K L 99.7% 114 27.1 13.3 108 0 3 0 0 2 1,829.9241 3,399.29 37,827.1 630 647 Empty false Q6PIC6,Q6PIE5 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 99.1% 1 1 2 0.00793% 6.65% LIIVEGCQR K Q 99.2% 44.5 26.7 22.2 31.0 0 2 0 0 2 1,087.5930 2,234.22 105126 699 707 Empty false Q6PIC6,Q6PIE5 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 99.1% 1 1 2 0.00793% 6.65% SPDFTNENPLETR R N 99.7% 84.4 25.1 14.5 84.4 0 2 0 0 2 1,519.7024 2,811.83 27,194.8 228 240 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 99.1% 1 1 2 0.00793% 6.65% VDNSSLTGESEPQTR K S 99.7% 70.1 25.0 14.3 63.1 0 1 0 0 2 1,619.7508 1,637.99 4,471.10 213 227 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus OX=10090 GN=Atp1a1 PE=1 SV=1 Q8VDN2 Atp1a1 uniprot_Mus-musculus_SP.fasta 112,985.3 99.1% 1 1 2 0.00793% 6.65% VIMVTGDHPITAK K A 95.1% 22.1 25.0 19.8 14.4 0 0 1 0 2 1,397.7460 1,939.33 65,012.2 613 625 Empty false Q64436,Q6PIC6,Q6PIE5 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) L-lactate dehydrogenase B chain OS=Mus musculus OX=10090 GN=Ldhb PE=1 SV=2 P16125 Ldhb uniprot_Mus-musculus_SP.fasta 36,572.4 99.1% 1 1 2 0.00793% 3.59% VIGSGCNLDSAR R F 99.7% 62.2 25.3 14.0 58.0 0 2 0 0 2 1,248.6002 1,764.67 33,172.6 159 170 Empty true P06151 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Cytochrome b-c1 complex subunit 2, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc2 PE=1 SV=1 Q9DB77 Uqcrc2 uniprot_Mus-musculus_SP.fasta 48,236.0 99.8% 1 1 2 0.00793% 2.21% AVAFQNSQTR K I 99.6% 45.2 25.5 19.4 38.8 0 2 0 0 2 1,121.5697 1,420.40 38,058.0 163 172 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% AIGIGAYLVR R L 99.7% 56.8 25.0 20.8 0.000 0 2 0 0 2 1,032.6201 3,451.17 87,436.9 1823 1832 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% AVVMDLLR K Q 96.1% 32.0 25.0 23.0 19.5 0 2 0 0 2 932.5235 2,753.27 56,593.1 984 991 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% DFTVASPAEFVTR R F 99.5% 47.9 25.3 13.2 47.9 0 2 0 0 2 1,439.7165 3,586.85 75,906.9 98 110 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% DKFEEDRIYR R H 99.7% 36.1 25.3 15.1 24.1 0 0 1 0 2 1,370.6700 1,860.81 62,337.7 1361 1370 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% EASFEYLQNEGER K L 99.7% 53.3 25.0 0.000 49.6 0 1 0 0 2 1,571.6972 2,695.47 30,840.8 1435 1447 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% EGLPLMVFANWR R G 99.7% 55.3 26.9 13.0 53.0 0 2 0 0 2 1,432.7406 4,904.16 19,950.2 2035 2046 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% EVFFMNTQSIVQLVQR R Y 94.6% 30.6 27.1 13.0 30.6 0 1 0 0 2 1,955.0056 4,220.62 10,289.5 958 973 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% FGGNKVIEK R V 98.9% 41.3 25.2 31.8 25.4 0 2 0 0 2 991.5572 1,399.83 74,331.9 111 119 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% FVVMVTPEDLK R A 99.7% 53.4 25.7 22.8 46.7 0 2 0 0 2 1,293.6761 3,196.82 64,125.3 152 162 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% GQVLPAHTLLNTVDVELIYEGIK R Y 99.7% 66.9 25.0 13.6 66.9 0 0 2 0 2 2,522.3868 4,692.84 54,778.1 657 679 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% GSVLEPEGTVEIK R F 98.7% 36.5 25.5 29.7 19.2 0 1 0 0 2 1,357.7211 2,698.42 41,257.6 2114 2126 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% GVINDILDWK K T 99.7% 58.0 26.2 22.9 46.9 0 2 0 0 2 1,172.6312 4,356.36 43,784.9 2199 2208 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% HLEPALAFQLELNR R M 99.7% 57.1 25.1 19.9 30.4 0 0 2 0 2 1,650.8963 3,700.23 87,226.5 1371 1384 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% HLEVQILADQYGNAISLFGR R D 99.5% 27.2 27.1 0.000 27.2 0 0 2 0 2 2,244.1773 4,564.66 27,604.1 356 375 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IDTGWLDR R L 99.0% 53.7 26.5 26.2 27.0 0 2 0 0 2 975.4896 2,917.51 72,348.9 607 614 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IDTGWLDRLIAEK R V 99.7% 34.9 25.7 18.4 30.9 0 0 2 0 2 1,529.8325 4,243.66 60,976.8 607 619 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IGLAEEIR R H 99.0% 61.8 25.0 35.6 36.0 0 2 0 0 2 900.5150 2,486.98 105586 1723 1730 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IIEFVPTK R A 96.7% 31.1 25.0 14.9 26.0 0 1 0 0 2 946.5609 2,770.20 31,095.3 1921 1928 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IIEFVPTKAPYDPR R W 98.2% 22.6 25.4 13.6 18.3 0 0 1 0 2 1,645.8950 3,093.02 51,539.2 1921 1934 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IIQQAGQVWFPDSAFK K T 99.7% 70.4 27.0 13.2 61.6 0 2 0 0 2 1,834.9488 3,876.65 39,359.2 2009 2024 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% ILNVPQDLYEK R G 98.8% 38.0 26.5 20.2 31.5 0 2 0 0 2 1,331.7207 3,094.26 138999 277 287 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% ITDIIGKEEGLGAENLR K G 99.7% 44.5 26.1 25.1 28.8 0 0 2 0 2 1,827.9814 2,958.52 74,190.7 1781 1797 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% ITSENPDEGFKPSSGTVQELNFR R S 99.7% 51.0 27.6 16.2 48.4 0 0 3 0 2 2,552.2265 3,041.24 62,230.1 509 531 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% IYVAANSGAR R I 98.5% 43.5 25.0 22.5 34.3 0 3 0 0 2 1,021.5424 1,468.99 166793 1713 1722 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% LGGIPVGVVAVETR R T 99.7% 47.5 25.0 13.1 36.0 0 2 0 0 2 1,366.8054 3,317.40 130378 1977 1990 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% LILSETSIFDVLPNFFYHSNQVVR K M 99.7% 36.8 26.7 13.1 33.0 0 0 2 0 2 2,838.4825 5,493.35 14,306.3 1122 1145 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% LLETESFQLNR K I 99.7% 72.7 26.0 18.7 59.2 0 2 0 0 2 1,349.7060 2,986.69 184449 596 606 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% LTFLVAQK R D 95.8% 29.3 25.0 18.4 14.6 0 1 0 0 2 919.5612 2,869.38 32,186.7 1326 1333 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% LTFLVAQKDFRK R Q 99.2% 30.2 25.0 15.2 28.5 0 0 1 0 2 1,465.8527 2,800.07 41,581.3 1326 1337 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% MAALEVYVR R R 99.5% 42.4 25.0 13.3 24.9 0 2 0 0 2 1,067.5554 2,585.33 94,775.5 1146 1154 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% MAALEVYVRR R A 97.2% 19.2 25.0 20.6 9.76 0 0 1 0 2 1,223.6565 2,241.17 58,319.3 1146 1155 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% MGGMVSFR R T 99.0% 52.8 25.0 16.8 37.6 0 2 0 0 2 916.4016 1,531.61 108584 1232 1239 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% MQLDNPSK K V 97.5% 36.3 25.0 20.3 22.9 0 2 0 0 2 948.4457 895.726 39,334.2 817 824 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% NSISNFLHSLER R G 99.7% 71.6 26.1 15.1 63.2 0 2 2 0 2 1,416.7229 4,023.50 134247 645 656 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% QGPLHGMLINTPYVTK K D 99.2% 26.6 26.4 13.0 15.9 0 0 2 0 2 1,784.9367 2,744.54 136415 1564 1579 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% QVLIASHLPSYELR R H 99.7% 73.9 25.0 0.000 73.9 0 2 1 0 2 1,625.9010 3,199.53 65,346.2 1082 1095 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% RAYIAYELNSVQHR R Q 99.7% 69.0 27.1 19.5 55.1 0 0 2 0 2 1,719.8924 2,512.36 137072 1155 1168 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% RLTFLVAQKDFR R K 99.7% 33.4 25.0 14.2 22.9 0 0 1 0 2 1,493.8588 2,957.09 33,624.3 1325 1336 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% SVHSSVPLLNSKDPIDR K I 99.7% 29.3 26.5 0.000 26.6 0 0 1 0 2 1,863.9924 2,546.63 118987 1904 1920 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% TAQIMFQAYGDK R Q 99.7% 56.8 25.0 0.000 56.2 0 2 0 0 2 1,388.6517 2,535.05 53,291.1 1552 1563 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% TCVFEKENDPSVMR K S 99.7% 40.8 25.0 17.6 35.2 0 0 2 0 2 1,727.7728 1,883.20 137403 741 754 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% TDGDIEDDRLAAMFR K E 99.5% 27.6 25.0 15.5 18.5 0 0 1 0 2 1,740.7861 2,824.94 50,686.5 1294 1308 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% TIQVENSHLILTGAGALNK R V 99.7% 32.9 25.0 13.1 7.91 0 0 2 0 2 1,979.0922 3,142.64 145494 1837 1855 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% TLRDPSLPLLELQDIMTSVSGR K I 99.7% 67.9 25.6 0.000 65.0 0 0 2 0 2 2,441.3072 5,245.46 12,294.9 887 908 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VETQFQNGHYDK R C 95.8% 21.2 25.0 14.4 6.00 0 0 1 0 2 1,466.6548 1,658.30 29,207.0 996 1007 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VEVGTEVTDYR K F 99.7% 70.2 25.0 20.7 70.2 0 2 0 0 2 1,267.6165 2,292.77 64,811.8 1409 1419 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VLIANNGIAAVK K C 99.7% 59.6 25.0 19.5 13.9 0 2 0 0 2 1,183.7046 2,710.78 77,135.5 120 131 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VNNADDFPNLFR K Q 99.7% 62.6 25.9 14.3 54.1 0 2 0 0 2 1,421.6808 3,630.15 56,630.1 323 334 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VQQAELHTGSLPQIQSTALR K G 99.7% 73.6 26.3 17.4 70.9 0 0 2 0 2 2,177.1675 2,946.26 95,882.4 825 844 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VQQAELHTGSLPQIQSTALRGEK K L 99.7% 53.1 26.3 0.000 51.5 0 0 2 0 2 2,491.3266 2,744.74 22,047.1 825 847 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% VSALNSVHCEHVEDEGESR R Y 99.7% 59.0 25.0 0.000 57.3 0 0 2 0 2 2,153.9516 1,807.15 33,723.5 1760 1778 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1 Q5SWU9 Acaca uniprot_Mus-musculus_SP.fasta 265,259.3 100.0% 52 56 96 0.381% 27.1% YLYLTPQDYKR K V 99.7% 37.7 26.9 18.6 32.1 0 0 2 0 2 1,459.7581 2,725.49 235232 1749 1759 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Serum albumin OS=Mus musculus OX=10090 GN=Alb PE=1 SV=3 P07724 Alb uniprot_Mus-musculus_SP.fasta 68,692.9 99.1% 1 1 2 0.00793% 2.14% LGEYGFQNAILVR K Y 99.7% 105 25.5 13.4 88.9 0 2 0 0 2 1,479.7955 3,628.99 134189 422 434 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% DGSYDMQIDNK R S 99.7% 44.0 25.0 0.000 44.0 0 2 0 0 2 1,301.5317 1,438.00 20,224.6 567 577 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% DLLPSHSTIAK K E 98.4% 35.5 25.0 18.1 25.6 0 1 0 0 2 1,181.6526 2,094.86 21,330.4 491 501 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% ESVCQAALGLILK K E 99.7% 87.6 26.0 26.3 81.8 0 2 3 0 2 1,401.7772 4,473.07 113715 502 514 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% ESVCQAALGLILKEK K E 99.6% 29.4 25.2 13.4 29.4 0 0 2 0 2 1,658.9148 4,186.34 35,250.3 502 516 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% HAPLVEFEEEESDK R - 99.7% 75.7 25.0 0.000 75.7 0 2 1 0 2 1,658.7545 2,580.94 53,329.5 704 717 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% IAAGEKIPLSQEEIPLQGHAFEAR R I 99.7% 60.8 26.2 13.1 60.7 0 0 3 0 2 2,604.3783 3,235.39 72,898.0 358 381 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% IIEEAPAPGINPEVR K R 99.7% 55.9 26.1 0.000 53.7 0 2 0 0 2 1,604.8644 2,626.33 44,569.3 281 295 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% IIEEAPAPGINPEVRR K K 99.7% 26.5 25.1 21.0 18.1 0 0 2 0 2 1,760.9655 2,359.30 165519 281 296 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% IPLSQEEIPLQGHAFEAR K I 99.7% 71.4 27.1 13.8 67.0 0 0 2 0 2 2,035.0609 3,206.50 110324 364 381 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% IYAEDPDNNFMPGAGPLVHLSTPSADMSTR R I 99.7% 48.5 26.0 13.0 0.000 0 0 1 0 2 3,236.4514 3,376.28 7,634.20 382 411 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% KVFFSEGAQANR K H 99.7% 48.2 25.1 26.2 34.2 0 0 2 0 2 1,353.6909 1,950.94 138797 692 703 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% LHTQDQFSPFSFSSGR K R 99.7% 62.6 25.1 0.000 62.6 0 2 2 0 2 1,840.8613 3,283.61 502344 524 539 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% LQVEHPVTEMITGTDLVEWQLR R I 99.7% 40.1 27.6 16.5 36.2 0 0 3 0 2 2,594.3286 4,361.76 59,304.1 336 357 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% LVVWASDR K Q 97.7% 39.0 27.6 21.0 22.0 0 1 0 0 2 945.5152 2,543.39 77,833.3 433 440 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% QGDEVSVHYDPMIAK R L 99.7% 27.7 25.0 16.8 26.0 0 0 1 0 2 1,704.7900 2,276.23 50,455.9 418 432 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% SDIVIAVTYNR K D 99.7% 68.2 25.0 0.000 55.9 0 2 0 0 2 1,250.6739 2,907.22 55,658.5 556 566 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% SEREFQEQLESARR R E 99.1% 33.2 26.8 19.3 25.9 0 0 1 0 2 1,764.8623 2,104.87 30,264.4 216 229 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% SGKSDIVIAVTYNR R D 99.7% 54.4 25.1 13.1 52.9 0 3 0 0 2 1,522.8224 2,591.91 39,830.6 553 566 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% SNVDFLLR R L 99.0% 47.9 25.0 28.5 35.5 0 4 0 0 2 963.5258 3,201.42 161114 461 468 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% VFFSEGAQANR K H 99.7% 70.8 25.0 19.1 62.8 0 2 0 0 2 1,225.5959 2,288.33 163181 693 703 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% VLGDLSSEDGCTYLK R S 99.7% 104 25.7 13.0 98.9 0 4 0 0 2 1,656.7788 2,962.95 63,110.5 581 595 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% YCLHQYNIVGLR R S 99.7% 47.7 26.7 17.6 33.7 0 2 2 0 2 1,535.7788 3,011.33 651620 449 460 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% YLSPVSAEGAQGGTIAPMTGTIEK K V 99.7% 36.9 28.0 18.2 32.1 0 0 2 0 2 2,394.1861 2,836.71 77,764.8 632 655 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Mccc1 PE=1 SV=2 Q99MR8 Mccc1 uniprot_Mus-musculus_SP.fasta 79,344.8 100.0% 24 28 59 0.234% 41.1% YVGAGTVEFIMDSR K H 99.7% 54.1 25.2 18.1 54.1 0 3 0 0 2 1,560.7364 3,198.40 65,631.7 311 324 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit O, mitochondrial OS=Mus musculus OX=10090 GN=Atp5po PE=1 SV=1 Q9DB20 Atp5po uniprot_Mus-musculus_SP.fasta 23,364.4 99.0% 1 1 1 0.00396% 6.57% LVRPPVQVYGIEGR K Y 99.7% 32.2 25.0 0.000 32.2 0 0 1 0 2 1,582.9065 2,857.94 49,020.3 27 40 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Hexokinase-1 OS=Mus musculus OX=10090 GN=Hk1 PE=1 SV=3 P17710 Hk1 uniprot_Mus-musculus_SP.fasta 108,305.7 99.1% 1 1 2 0.00793% 1.54% SANLVAATLGAILNR R L 99.6% 25.8 25.0 13.1 25.8 0 0 2 0 2 1,483.8591 5,157.74 10,573.6 438 452 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 2 2 2 0.00793% 7.34% IGAGDYQPTEQDILR R T 98.9% 41.4 27.0 13.0 40.3 0 1 0 0 2 1,675.8289 2,945.74 18,704.9 163 177 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Guanine nucleotide-binding protein G(o) subunit alpha OS=Mus musculus OX=10090 GN=Gnao1 PE=1 SV=3 P18872 Gnao1 uniprot_Mus-musculus_SP.fasta 40,085.8 100.0% 2 2 2 0.00793% 7.34% LLLLGAGESGK K S 99.7% 44.6 25.0 13.3 0.000 0 1 0 0 2 1,057.6254 2,913.38 45,989.2 36 46 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% ALEHFTDLYDIKR R A 99.7% 40.7 26.8 14.3 38.8 0 0 1 0 2 1,620.8382 2,993.23 34,953.7 626 638 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% KFNALFAQGNYSEAAK R V 99.6% 27.4 26.8 0.000 22.6 0 0 2 0 2 1,758.8809 2,824.58 58,128.7 367 382 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% LHIIEVGTPPTGNQPFPK K K 99.7% 28.9 25.5 0.000 22.5 0 0 2 0 2 1,945.0545 3,151.30 73,186.0 228 245 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% LKLLLPWLEAR R I 99.7% 29.8 25.0 0.000 29.8 0 0 1 0 2 1,351.8462 4,480.65 9,800.30 855 865 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% LLLPWLEAR K I 99.1% 38.5 25.0 28.9 32.9 0 2 0 0 2 1,110.6671 4,470.10 29,900.4 857 865 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3 Q68FD5 Cltc uniprot_Mus-musculus_SP.fasta 191,560.9 100.0% 6 6 10 0.0396% 4.12% LLYNNVSNFGR K L 99.7% 59.4 25.1 14.1 59.4 0 2 0 0 2 1,296.6694 2,918.16 73,460.8 1216 1226 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Mus musculus OX=10090 GN=Pdha1 PE=1 SV=1 P35486 Pdha1 uniprot_Mus-musculus_SP.fasta 43,232.5 97.8% 1 1 2 0.00793% 2.31% AILAELTGR R R 99.4% 52.0 25.0 16.8 35.7 0 2 0 0 2 943.5572 3,042.67 58,333.5 133 141 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Calcium-binding mitochondrial carrier protein Aralar1 OS=Mus musculus OX=10090 GN=Slc25a12 PE=1 SV=1 Q8BH59 Slc25a12 uniprot_Mus-musculus_SP.fasta 74,571.8 99.3% 1 1 1 0.00396% 2.51% VSALNVLQDLGLFGLYK R G 98.6% 24.0 25.0 0.000 24.0 0 0 1 0 2 1,850.0424 5,716.46 4,310.50 466 482 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 3-ketoacyl-CoA thiolase, mitochondrial OS=Mus musculus OX=10090 GN=Acaa2 PE=1 SV=3 Q8BWT1 Acaa2 uniprot_Mus-musculus_SP.fasta 41,830.2 97.9% 1 1 2 0.00793% 3.53% VGVPTETGALTLNR R L 99.4% 40.6 25.1 13.5 40.6 0 2 0 0 2 1,427.7854 2,820.19 48,340.2 77 90 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Eukaryotic translation initiation factor 5A-1 OS=Mus musculus OX=10090 GN=Eif5a PE=1 SV=2 P63242 Eif5a uniprot_Mus-musculus_SP.fasta 16,832.7 94.3% 1 1 1 0.00396% 15.6% YDCGEEILITVLSAMTEEAAVAIK K A 98.3% 30.0 27.9 0.000 27.5 0 0 1 0 2 2,626.2993 6,547.05 2,326.10 127 150 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% AVFVDLEPTVIDEVR R T 99.7% 54.4 26.3 15.7 41.5 0 2 0 0 2 1,701.9059 4,071.60 76,283.8 65 79 Empty true P68369 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% DVNAAIATIK K T 99.1% 40.1 26.8 21.1 31.6 0 2 0 0 2 1,015.5783 2,520.53 79,990.5 327 336 Empty true P68369 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% EIIDLVLDR K I 99.1% 43.9 25.0 24.3 39.0 0 2 0 0 2 1,085.6203 3,796.90 42,676.1 113 121 Empty true P68369 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% GHYTIGKEIIDLVLDR R I 99.7% 54.7 25.3 13.1 44.9 0 0 4 0 2 1,842.0123 4,657.05 73,326.3 106 121 Empty true P68369 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% IHFPLATYAPVISAEK R A 99.7% 35.6 25.5 22.4 27.3 0 0 2 0 2 1,756.9633 3,778.14 94,129.7 265 280 Empty true P68369,P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% LDHKFDLMYAK R R 95.3% 20.2 25.4 0.000 20.2 0 0 1 0 2 1,396.6932 2,267.15 72,943.3 391 401 Empty true P68369,P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% LISQIVSSITASLR R F 99.7% 83.4 25.0 13.6 79.0 0 2 3 0 2 1,487.8792 4,935.06 44,674.5 230 243 Empty true P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% QLFHPEQLITGK R E 99.7% 37.5 25.0 13.4 37.5 0 0 2 0 2 1,410.7742 3,145.30 44,998.0 85 96 Empty true P68369,P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% QLFHPEQLITGKEDAANNYAR R G 99.7% 58.2 28.5 0.000 56.7 0 0 1 0 2 2,415.2053 3,066.64 30,233.4 85 105 Empty true P68369,P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin alpha-1B chain OS=Mus musculus OX=10090 GN=Tuba1b PE=1 SV=2 P05213 Tuba1b uniprot_Mus-musculus_SP.fasta 50,151.7 100.0% 10 11 23 0.0912% 26.8% VGINYQPPTVVPGGDLAK K V 97.9% 43.8 25.0 13.2 43.8 0 2 0 0 2 1,824.9857 3,218.20 60,463.3 353 370 Empty true P68369,P68368 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 8 0.0317% 13.7% FVTVQTISGTGALR R V 99.7% 78.4 25.0 15.6 78.4 0 2 0 0 2 1,449.8061 3,072.22 57,114.6 126 139 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 8 0.0317% 13.7% IAATILTSPDLR R K 99.7% 74.7 25.0 13.4 66.2 0 1 0 0 2 1,270.7367 3,141.43 40,238.7 326 337 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 8 0.0317% 13.7% ILIRPLYSNPPLNGAR K I 98.1% 22.4 25.0 13.1 5.26 0 0 1 0 2 1,795.0227 3,171.04 38,071.4 310 325 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 8 0.0317% 13.7% VGAFTVVCK R D 99.7% 53.9 25.0 14.6 50.9 0 2 0 0 2 980.5234 2,346.49 69,919.7 288 296 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aspartate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Got2 PE=1 SV=1 P05202 Got2 uniprot_Mus-musculus_SP.fasta 47,412.3 100.0% 5 5 8 0.0317% 13.7% VGASFLQR R F 99.0% 65.7 25.0 24.6 38.1 0 2 0 0 2 877.4890 2,313.68 74,354.8 140 147 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus OX=10090 GN=Idh3g PE=1 SV=1 P70404 Idh3g uniprot_Mus-musculus_SP.fasta 42,785.6 98.1% 1 1 1 0.00396% 2.54% HKDIDILIVR R E 99.4% 26.3 25.0 13.0 23.5 0 0 1 0 2 1,221.7316 2,663.13 28,699.5 158 167 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Eukaryotic initiation factor 4A-I OS=Mus musculus OX=10090 GN=Eif4a1 PE=1 SV=1 P60843 Eif4a1 uniprot_Mus-musculus_SP.fasta 46,155.3 87.1% 1 1 1 0.00396% 4.19% TATFAISILQQIELDLK K A 94.8% 29.4 25.0 0.000 27.8 0 1 0 0 2 1,904.0742 5,784.44 1,397.80 83 99 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Beta-actin-like protein 2 OS=Mus musculus OX=10090 GN=Actbl2 PE=1 SV=1 Q8BFZ3 Actbl2 uniprot_Mus-musculus_SP.fasta 42,005.1 97.6% 1 1 1 0.00396% 9.04% SYELPDGQVITIGNER R F 99.7% 59.8 27.7 13.4 52.4 0 2 0 0 2 1,790.8921 3,612.27 41,013.3 240 255 Empty false P63260,P60710 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Beta-actin-like protein 2 OS=Mus musculus OX=10090 GN=Actbl2 PE=1 SV=1 Q8BFZ3 Actbl2 uniprot_Mus-musculus_SP.fasta 42,005.1 97.6% 1 1 1 0.00396% 9.04% VAPDEHPILLTEAPLNPK R I 99.3% 25.8 25.0 0.000 3.25 0 0 1 0 2 1,954.0647 2,977.73 96,829.7 97 114 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 2 2 4 0.0159% 5.02% DLKPENLLLASK R L 99.7% 27.4 25.0 17.4 27.4 0 0 2 0 2 1,340.7786 3,140.70 35,414.4 135 146 Empty true P28652 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus OX=10090 GN=Camk2a PE=1 SV=2 P11798 Camk2a uniprot_Mus-musculus_SP.fasta 54,115.7 100.0% 2 2 4 0.0159% 5.02% ITQYLDAGGIPR R T 99.7% 57.2 25.9 18.9 52.5 0 2 0 0 2 1,303.7007 2,808.22 55,590.1 434 445 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 5 5 9 0.0357% 17.5% AGAGSATLSMAYAGAR K F 99.7% 50.1 25.0 0.000 50.1 0 1 0 0 2 1,470.7006 2,158.02 18,688.3 242 257 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 5 5 9 0.0357% 17.5% ANTFVAELK R G 99.7% 51.5 25.0 13.2 42.6 0 2 0 0 2 992.5411 2,635.33 74,938.0 177 185 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 5 5 9 0.0357% 17.5% GCDVVVIPAGVPR K K 99.7% 49.2 25.0 16.5 40.9 0 2 0 0 2 1,338.7200 3,050.09 72,795.4 92 104 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 5 5 9 0.0357% 17.5% IFGVTTLDIVR K A 99.7% 48.8 25.0 20.9 41.9 0 2 0 0 2 1,233.7203 3,959.21 48,735.4 166 176 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Malate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Mdh2 PE=1 SV=3 P08249 Mdh2 uniprot_Mus-musculus_SP.fasta 35,611.9 100.0% 5 5 9 0.0357% 17.5% IQEAGTEVVK R A 99.6% 46.2 26.9 32.5 15.3 0 2 0 0 2 1,073.5838 1,468.80 60,126.5 230 239 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 3 3 5 0.0198% 7.30% AEAGDNLGALVR R G 99.7% 86.9 25.0 24.1 74.2 0 2 0 0 2 1,185.6223 2,666.58 70,946.7 316 327 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 3 3 5 0.0198% 7.30% KGDECELLGHNK K N 97.3% 22.8 25.0 13.4 22.8 0 0 1 0 2 1,399.6637 1,383.66 29,250.7 286 297 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Elongation factor Tu, mitochondrial OS=Mus musculus OX=10090 GN=Tufm PE=1 SV=1 Q8BFR5 Tufm uniprot_Mus-musculus_SP.fasta 49,508.9 100.0% 3 3 5 0.0198% 7.30% TTLTAAITK K I 99.0% 38.6 25.0 14.4 38.6 0 2 0 0 2 919.5460 2,223.58 78,764.0 71 79 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutaminase kidney isoform, mitochondrial OS=Mus musculus OX=10090 GN=Gls PE=1 SV=1 D3Z7P3 Gls uniprot_Mus-musculus_SP.fasta 73,964.6 100.0% 1 1 2 0.00793% 2.82% SVINLLFAAYTGDVSALRR K F 99.7% 36.8 25.0 13.5 25.5 0 0 2 0 2 2,066.1393 5,122.83 33,741.8 558 576 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ACTELGIR R T 98.6% 36.9 26.4 21.2 21.5 0 2 0 0 2 919.4667 1,854.96 104508 55 62 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ADEAYLIGR K G 99.2% 38.8 25.1 18.0 31.9 0 2 0 0 2 1,007.5157 2,436.17 115571 80 88 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ADFAQACQDAGVR R F 99.7% 81.3 25.0 18.5 70.5 0 2 0 0 2 1,408.6275 2,111.90 62,250.1 125 137 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% AEAEAQAEELSFPR R S 99.7% 109 25.1 15.2 93.0 0 5 2 0 2 1,547.7336 2,824.36 439203 929 942 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% AGTHILCIK R D 99.6% 42.5 25.0 16.9 42.2 0 2 0 0 2 1,012.5610 2,012.93 100177 733 741 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ALAVSDLNR K A 99.7% 57.7 26.0 16.7 34.3 0 4 0 0 2 958.5316 2,112.47 1754740 1062 1070 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% AVRNHQGLLLMDTTFR R D 98.6% 33.6 27.5 14.7 1.000 0 0 1 0 2 1,888.9700 2,804.49 27,251.5 556 571 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% AYSEALAAFGNGALFVEK R F 99.7% 83.8 27.3 21.0 74.0 0 7 4 0 2 1,857.9381 4,225.51 209147 220 237 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% AYVEANQMLGDLIK K V 99.7% 113 26.6 31.2 107 0 2 1 0 2 1,580.7991 3,219.92 67,016.2 893 906 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% DFTATFGPLDSLNTR K L 99.7% 63.2 26.4 13.0 61.7 0 6 0 0 2 1,654.8073 3,940.22 106881 1022 1036 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% DTQAMKEMHFHPK K A 98.8% 23.6 25.0 13.0 23.6 0 0 2 0 2 1,631.7307 900.238 120729 1091 1103 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% DVKGQIGAPMPGK K V 99.7% 74.3 25.0 14.2 67.0 0 2 2 0 2 1,313.6886 1,501.89 95,331.1 1107 1119 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% EGPEGFAR R A 99.0% 56.8 25.0 18.6 43.3 0 4 0 0 2 862.4054 1,624.15 533323 548 555 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ELIPNIPFQMLLR R G 99.7% 63.0 25.0 23.7 61.3 0 2 2 0 2 1,583.8980 5,033.70 135449 632 644 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% ENGVDAVHPGYGFLSER K A 99.7% 32.2 25.3 15.1 28.5 0 0 5 0 2 1,847.8560 3,089.71 227748 108 124 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% FCEVAKENGMDVFR K V 99.7% 42.5 25.0 13.1 42.5 0 0 8 0 2 1,717.7673 2,628.90 371196 662 675 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% FIGPSPEVVR R K 99.7% 53.7 26.0 25.5 43.5 0 2 0 0 2 1,100.6099 2,534.06 273088 138 147 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% GANAVGYTNYPDNVVFK R F 99.7% 70.1 26.4 0.000 3.32 0 5 0 0 2 1,828.8864 3,148.04 292580 645 661 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% GLAPVQAYLHIPDIIK R V 99.7% 56.0 25.0 0.000 56.0 0 2 3 0 2 1,748.0108 4,295.10 285429 89 104 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% GLYAAFDCTATMK R S 99.7% 71.5 25.0 13.4 71.5 0 1 0 0 2 1,464.6499 2,829.35 22,765.9 843 855 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% GQIGAPMPGK K V 99.7% 57.9 25.0 14.1 57.9 0 3 0 0 2 971.4982 1,322.80 812417 1110 1119 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% GTPLDTEVPLER K V 99.7% 63.0 25.0 14.2 57.4 0 2 0 0 2 1,326.6902 2,781.84 454513 819 830 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% HGEEVTPEDVLSAAMYPDVFAQFK R D 99.7% 41.7 26.8 13.7 40.0 0 0 3 0 2 2,696.2551 4,537.90 44,039.5 998 1021 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% HIEVQILGDQYGNILHLYER R D 99.7% 73.3 27.7 13.4 73.3 0 0 2 0 2 2,410.2516 4,122.46 73,329.5 244 263 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% HYFIEVNSR K L 99.7% 51.7 25.0 21.1 51.7 0 4 0 0 2 1,165.5636 2,353.37 126358 320 328 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IAEEFEVELER K G 99.7% 89.6 26.3 27.9 71.5 0 4 0 0 2 1,363.6740 3,293.27 1528960 1044 1054 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IAEEFEVELERGK K T 99.7% 41.9 26.7 24.0 35.2 0 0 2 0 2 1,548.7905 2,955.28 243640 1044 1056 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IAPYVAHNFNK K L 99.6% 44.6 26.6 18.8 38.0 0 2 0 0 2 1,273.6687 2,004.32 101079 590 600 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IEGRPGASLPPLNLK R E 99.7% 47.2 25.0 0.000 47.2 0 2 3 0 2 1,561.9063 2,916.10 678223 974 988 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IEGRPGASLPPLNLKELEKDLIDR R H 99.7% 39.1 25.0 0.000 39.1 0 0 3 0 2 2,673.4939 4,313.90 59,614.3 974 997 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% INGCAIQCR R V 99.7% 72.8 25.0 20.1 46.2 0 2 0 0 2 1,092.4926 1,509.76 278534 369 377 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% IVGDLAQFMVQNGLSR K A 99.7% 99.7 27.3 13.2 18.8 0 14 3 0 2 1,764.8951 3,546.14 644724 913 928 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% KAYVEANQMLGDLIK K V 99.7% 65.8 26.6 18.0 65.8 0 1 2 0 2 1,708.8941 2,903.93 145226 892 906 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% KIAPYVAHNFNK K L 99.7% 54.2 26.4 17.3 50.0 0 0 4 0 2 1,401.7637 1,842.37 314395 589 600 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% LDNASAFQGAVISPHYDSLLVK R V 99.7% 67.2 27.5 14.9 62.8 0 0 2 0 2 2,345.2137 3,662.32 347761 407 428 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% LQELRELIPNIPFQMLLR R G 99.7% 31.6 25.0 13.1 28.8 0 0 4 0 2 2,239.2635 4,848.67 65,823.7 627 644 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% NHQGLLLMDTTFR R D 99.7% 32.2 27.2 15.0 25.0 0 0 2 0 2 1,545.7844 3,384.36 90,621.1 559 571 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% QKADEAYLIGR R G 99.7% 53.8 25.3 14.4 51.2 0 2 0 0 2 1,263.6693 2,068.90 151186 78 88 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% QVFFELNGQLR R S 99.7% 73.3 25.2 22.3 62.6 0 7 0 0 2 1,350.7165 3,683.10 657471 1075 1085 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% QVGYENAGTVEFLVDKHGK K H 99.7% 48.4 28.1 16.2 42.5 0 0 2 0 2 2,091.0507 2,975.69 138948 301 319 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% SFQPDTGRIEVFR R S 99.7% 35.9 26.4 18.2 30.2 0 1 1 0 2 1,551.7915 2,904.85 114562 386 398 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% SILVKDTQAMK R E 99.7% 51.4 25.0 22.0 46.0 0 2 0 0 2 1,249.6823 1,389.90 26,544.0 1086 1096 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% SSSAPVASPNVR R R 99.7% 48.1 25.0 26.8 39.6 0 2 0 0 2 1,171.6064 1,445.96 207672 19 30 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% SVVEFLQGYIGIPHGGFPEPFR R S 99.7% 74.4 27.3 13.1 73.8 0 0 8 0 2 2,446.2556 4,947.86 205136 943 964 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% TKYSLEYYMGLAEELVR R A 99.7% 60.0 27.7 20.6 55.7 0 0 4 0 2 2,065.0311 5,042.62 70,196.2 716 732 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% TVAVYSEQDTGQMHR R Q 99.7% 40.1 25.0 17.5 36.5 0 0 2 0 2 1,737.7862 1,502.97 139697 63 77 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VAKENGVDAVHPGYGFLSER K A 99.7% 74.1 27.6 0.000 74.1 0 0 6 0 2 2,145.0724 2,831.33 199934 105 124 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VFDYSEYWEGAR R G 99.7% 91.7 25.0 17.6 83.2 0 2 0 0 2 1,521.6644 3,525.39 127923 831 842 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VIAHGKDHPTAATK K M 99.7% 36.3 26.2 18.5 28.9 0 0 2 0 2 1,445.7861 750.642 21,479.0 429 442 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VMVANRGEIAIR K V 99.5% 28.4 25.7 16.5 24.4 0 0 2 0 2 1,344.7417 1,986.30 289587 40 51 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VTTEDPAR R S 97.2% 32.6 25.0 21.9 25.4 0 1 0 0 2 888.4422 828.089 55,676.3 378 385 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VVEIAPATHLDPQLR K S 99.7% 72.3 25.0 14.2 69.8 0 2 3 0 2 1,658.9226 2,889.41 614984 274 288 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% VVHSYEELEENYTR R A 99.7% 68.8 25.0 13.6 62.1 0 2 4 0 2 1,767.8183 2,564.90 305529 206 219 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Pyruvate carboxylase, mitochondrial OS=Mus musculus OX=10090 GN=Pc PE=1 SV=1 Q05920 Pc uniprot_Mus-musculus_SP.fasta 129,685.9 100.0% 54 88 206 0.817% 52.6% YSLEYYMGLAEELVR K A 99.7% 56.2 27.1 13.3 33.3 0 2 5 0 2 1,851.8834 4,698.67 60,894.2 718 732 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 2 2 4 0.0159% 4.34% EAECVEADSGR R L 99.6% 45.4 25.0 0.000 45.4 0 2 0 0 2 1,222.5005 998.936 16,267.9 182 192 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cuticular Hb5 OS=Mus musculus OX=10090 GN=Krt85 PE=1 SV=2 Q9Z2T6 Krt85 uniprot_Mus-musculus_SP.fasta 55,758.8 100.0% 2 2 4 0.0159% 4.34% LALDIEIATYR K R 99.7% 63.3 25.0 0.000 58.8 0 2 0 0 2 1,277.7101 3,789.01 94,548.6 414 424 Empty true Q6NXH9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% AKDINQEVYNFLATAGAK R Y 99.7% 52.1 27.2 0.000 45.8 0 0 2 0 2 1,953.0077 4,084.37 54,514.3 143 160 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% ATIERDGYAQILR R D 99.7% 35.3 25.9 19.1 24.5 0 0 2 0 2 1,505.8072 2,603.80 110023 425 437 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% DGYAQILR R D 94.7% 29.4 25.1 15.5 24.0 0 1 0 0 2 935.4946 2,554.28 72,170.0 430 437 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% DINQEVYNFLATAGAK K Y 99.7% 63.4 26.3 16.0 58.0 0 0 3 0 2 1,753.8756 4,755.21 33,951.2 145 160 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% FKLEAPDADELPR K S 99.7% 39.8 26.2 18.3 33.9 0 0 2 0 2 1,500.7695 3,028.48 103517 522 534 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% IVYGHLDDPANQEIER K G 99.7% 46.5 26.4 0.000 41.7 0 0 2 0 2 1,868.9139 2,501.49 140173 69 84 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% LTGSLSGWTSPK K D 99.6% 45.2 26.8 14.0 43.2 0 2 0 0 2 1,233.6475 2,778.53 92,145.8 234 245 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% NAVTQEFGPVPDTAR R Y 99.7% 75.1 26.1 18.9 58.3 0 2 0 0 2 1,601.7919 2,755.66 29,304.1 634 648 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% SQFTITPGSEQIR K A 97.3% 33.2 26.6 17.4 24.9 0 2 0 0 2 1,463.7490 2,682.80 47,374.2 412 424 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% VAMSHFEPSEYIR K Y 98.9% 24.9 25.0 0.000 20.3 0 0 2 0 2 1,581.7366 2,616.18 85,087.8 32 44 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% VDVSPTSQR R L 97.2% 34.8 26.1 20.9 27.5 0 1 0 0 2 988.5058 1,218.32 42,667.6 556 564 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aconitate hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Aco2 PE=1 SV=1 Q99KI0 Aco2 uniprot_Mus-musculus_SP.fasta 85,465.9 100.0% 12 12 23 0.0912% 17.6% WVVIGDENYGEGSSR R E 99.7% 80.7 25.0 0.000 80.7 0 2 0 0 2 1,667.7660 3,051.32 23,973.0 657 671 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.1% 1 2 3 0.0119% 7.25% ASLENSLEETKGR K Y 99.7% 67.1 26.9 0.000 56.0 0 2 1 0 2 1,433.7231 1,997.84 107244 351 363 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.1% 1 2 3 0.0119% 7.25% TRLEQEIATYR K R 99.2% 39.0 25.8 0.000 39.0 0 1 0 0 2 1,379.7278 2,571.25 24,677.0 404 414 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.1% 1 2 3 0.0119% 7.25% TRLEQEIATYRR K L 99.7% 35.0 26.0 17.8 25.7 0 0 2 0 2 1,535.8289 2,352.12 161070 404 415 Empty false Q9QWL7,Q61781,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3 Q9Z2K1 Krt16 uniprot_Mus-musculus_SP.fasta 51,607.7 99.1% 1 2 3 0.0119% 7.25% VTMQNLNDR K L 99.7% 79.4 25.1 26.6 0.000 0 5 0 0 2 1,106.5260 1,042.01 198117 115 123 Empty false P02535,Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 33.6% 0 0 0 0.000% 6.47% GVGIISEGNETVEDIAAR K L 99.7% 114 27.1 13.3 108 0 3 0 0 2 1,829.9241 3,399.29 37,827.1 627 644 Empty false Q6PIC6,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 33.6% 0 0 0 0.000% 6.47% LIIVEGCQR K Q 99.2% 44.5 26.7 22.2 31.0 0 2 0 0 2 1,087.5930 2,234.22 105126 696 704 Empty false Q6PIC6,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 33.6% 0 0 0 0.000% 6.47% LNIPVSQVNPR R E 99.7% 47.4 25.0 20.2 39.6 0 2 0 0 2 1,236.7059 2,588.73 70,192.0 645 655 Empty false Q6PIC6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 33.6% 0 0 0 0.000% 6.47% VDNSSLTGESEPQTR K S 99.7% 70.1 25.0 14.3 63.1 0 1 0 0 2 1,619.7508 1,637.99 4,471.10 211 225 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus OX=10090 GN=Atp1a2 PE=1 SV=1 Q6PIE5 Atp1a2 uniprot_Mus-musculus_SP.fasta 112,220.7 33.6% 0 0 0 0.000% 6.47% VIMVTGDHPITAK K A 95.1% 22.1 25.0 19.8 14.4 0 0 1 0 2 1,397.7460 1,939.33 65,012.2 610 622 Empty false Q64436,Q6PIC6,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% DVAGDASESALLK R C 99.7% 76.9 26.8 19.0 58.5 0 2 0 0 2 1,275.6428 2,504.03 48,453.2 436 448 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% GVGIISEGNETVEDIAAR K L 99.7% 114 27.1 13.3 108 0 3 0 0 2 1,829.9241 3,399.29 37,827.1 620 637 Empty true Q6PIE5,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% LIIVEGCQR K Q 99.2% 44.5 26.7 22.2 31.0 0 2 0 0 2 1,087.5930 2,234.22 105126 689 697 Empty true Q6PIE5,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% LNIPVSQVNPR R D 99.7% 47.4 25.0 20.2 39.6 0 2 0 0 2 1,236.7059 2,588.73 70,192.0 638 648 Empty true Q6PIE5 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% MQVNAEEVVVGDLVEIK K G 96.8% 21.9 27.2 13.4 21.9 0 0 1 0 2 1,887.9734 4,182.17 14,543.6 168 184 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% MSVEEVCR K K 99.0% 43.2 25.0 19.5 20.7 0 1 0 0 2 1,025.4390 1,251.78 17,661.3 36 43 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% VDNSSLTGESEPQTR K S 99.7% 70.1 25.0 14.3 63.1 0 1 0 0 2 1,619.7508 1,637.99 4,471.10 203 217 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus OX=10090 GN=Atp1a3 PE=1 SV=1 Q6PIC6 Atp1a3 uniprot_Mus-musculus_SP.fasta 111,694.4 100.0% 8 8 13 0.0515% 10.3% VIMVTGDHPITAK K A 95.1% 22.1 25.0 19.8 14.4 0 0 1 0 2 1,397.7460 1,939.33 65,012.2 603 615 Empty true Q64436,Q6PIE5,Q8VDN2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Triosephosphate isomerase OS=Mus musculus OX=10090 GN=Tpi1 PE=1 SV=4 P17751 Tpi1 uniprot_Mus-musculus_SP.fasta 32,191.3 92.2% 1 1 1 0.00396% 3.34% IAVAAQNCYK K V 97.6% 34.7 25.0 13.2 34.1 0 1 0 0 2 1,137.5721 1,677.19 19,432.0 110 119 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 2 2 3 0.0119% 6.59% AAQEEYIKR K A 99.6% 46.3 25.1 0.000 46.3 0 2 0 0 2 1,107.5793 1,236.41 20,898.6 323 331 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Fructose-bisphosphate aldolase A OS=Mus musculus OX=10090 GN=Aldoa PE=1 SV=2 P05064 Aldoa uniprot_Mus-musculus_SP.fasta 39,356.5 100.0% 2 2 3 0.0119% 6.59% RLQSIGTENTEENRR K F 99.7% 35.0 27.5 20.7 18.5 0 0 1 0 2 1,802.9104 1,323.31 23,314.1 43 57 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% AKVNTIPGFDGVVKDADEAVR R I 99.7% 54.0 27.1 14.9 52.2 0 0 2 0 2 2,201.1563 3,289.95 252166 183 203 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% AQAVHPGYGFLSENK R E 99.7% 36.2 26.7 13.4 35.3 0 0 2 0 2 1,617.8020 2,542.82 82,485.2 132 146 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% AQAVHPGYGFLSENKEFAK R R 99.7% 39.0 27.8 0.000 39.0 0 0 3 0 2 2,093.0451 2,795.09 87,755.1 132 150 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% EAGGNMSIQFLGTVYK R V 98.4% 48.2 26.1 0.000 18.4 0 1 0 0 2 1,731.8260 3,504.88 9,661.00 616 631 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% FLSDVYPDGFK K G 99.7% 56.8 25.0 20.4 48.0 0 2 0 0 2 1,287.6257 3,306.23 375281 499 509 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% FQEHSRVPVIRPDVAK R W 97.3% 19.3 25.0 13.2 17.4 0 0 1 0 2 1,878.0345 2,035.57 59,934.7 539 554 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% FSSQEAASSFGDDR R L 99.7% 119 25.0 14.9 119 0 2 0 0 2 1,503.6346 2,270.73 67,780.9 240 253 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% FSSQEAASSFGDDRLLIEK R F 99.7% 46.2 27.4 13.5 42.3 0 0 3 0 2 2,100.0245 3,269.67 1047970 240 258 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% FVKGDISTK R F 99.7% 49.2 25.0 17.4 47.7 0 2 0 0 2 994.5569 1,219.99 95,086.6 490 498 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% GHTLTLSER K N 96.3% 31.1 25.0 15.3 31.1 0 1 0 0 2 1,013.5375 1,515.25 46,980.8 510 518 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% GVTHNIPLLR R E 99.7% 47.0 25.0 13.1 23.8 0 2 0 0 2 1,119.6634 2,541.27 331685 473 482 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% HGNALWLNER K E 95.0% 38.4 25.0 13.4 38.4 0 1 0 0 2 1,209.6123 2,433.27 33,423.5 275 284 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% HIEIQVLGDK R H 99.7% 49.9 25.0 13.3 42.9 0 2 0 0 2 1,151.6421 2,519.76 80,105.0 265 274 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% HKQEDIPISGWAVECR R V 99.7% 48.8 27.2 0.000 41.6 0 0 2 0 2 1,924.9336 2,819.01 176796 380 395 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% IAWDDEETR R D 97.1% 44.4 25.0 14.4 37.0 0 2 0 0 2 1,134.5063 2,203.25 113015 227 235 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% IAWDDEETRDGFR R F 99.7% 36.7 25.0 16.2 28.5 0 1 4 0 2 1,609.7243 2,676.36 1136960 227 239 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% ILIANRGEIACR K V 97.8% 21.2 26.2 20.5 13.4 0 0 1 0 2 1,385.7683 2,138.75 58,451.7 62 73 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% LAAELNKFMLEK K V 99.7% 49.6 25.0 20.9 44.4 0 1 3 0 2 1,406.7713 3,057.30 188985 638 649 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% LAAELNKFMLEKVPK K D 99.7% 36.8 25.0 13.7 36.8 0 0 4 0 2 1,730.9875 3,066.14 233176 638 652 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% LQVEHPVTECITGLDLVQEMILVAK R G 99.7% 53.7 25.7 17.0 50.0 0 0 5 0 2 2,835.4999 5,159.12 50,500.4 350 374 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% LSQYQEPIHLPGVR R V 99.7% 54.8 25.4 21.9 53.5 0 2 6 0 2 1,636.8807 3,029.41 3251950 413 426 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% LVTYGSDRAEALK K R 99.7% 49.6 25.0 16.9 30.4 0 1 0 0 2 1,422.7588 1,978.11 43,887.8 448 460 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% MADEAVCVGPAPTSK K S 99.7% 113 25.0 19.4 105 0 2 0 0 2 1,548.7034 1,841.12 47,930.5 101 115 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% MEDALDNYVIR R G 99.7% 64.3 25.0 21.9 53.9 0 2 0 0 2 1,354.6309 2,953.55 69,155.5 462 472 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% NFYFLEMNTR K L 98.4% 35.1 25.0 13.1 20.9 0 3 0 0 2 1,334.6197 3,872.73 197972 340 349 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% NQKVVEEAPSIFLDPETR R Q 99.7% 40.5 27.4 13.2 37.5 0 0 2 0 2 2,072.0660 3,310.25 178035 292 309 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% NQLLAIASSVFVASQLR R A 99.7% 124 25.0 13.6 118 0 4 14 0 2 1,817.0279 5,249.88 182406 519 535 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% QAMGEQAVALAK R A 99.7% 88.1 26.4 19.3 69.0 0 4 0 0 2 1,232.6305 1,938.23 341154 310 321 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% QEDIPISGWAVECR K V 99.3% 51.7 25.2 17.8 47.2 0 2 0 0 2 1,659.7797 3,402.04 28,710.4 382 395 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% RMEDALDNYVIR K G 99.7% 45.8 26.2 19.2 35.7 0 0 4 0 2 1,494.7370 2,840.05 131059 461 472 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% SFGLPSIGR K L 99.2% 40.9 25.1 22.3 37.5 0 2 0 0 2 933.5153 3,206.12 340401 404 412 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% SYLNMDAIMEAIK K K 99.7% 45.1 25.0 13.0 43.2 0 2 0 0 2 1,530.7180 3,128.90 30,522.6 116 128 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% SYLNMDAIMEAIKK K T 99.7% 32.6 26.2 15.9 25.7 0 0 2 0 2 1,626.8231 4,216.81 64,271.6 116 129 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% TFDKILIANRGEIACR K V 99.6% 27.6 25.7 13.1 26.3 0 0 1 0 2 1,877.0064 2,801.41 35,931.0 58 73 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% TVAIHSDVDASSVHVK K M 99.7% 72.1 27.3 15.0 71.3 0 0 2 0 2 1,664.8602 1,923.68 92,841.1 85 100 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% VNTIPGFDGVVKDADEAVR K I 99.1% 25.2 27.4 17.8 19.4 0 0 1 0 2 2,002.0242 3,544.27 225267 185 203 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% VPVIRPDVAK R W 99.7% 56.7 25.0 16.1 44.8 0 2 0 0 2 1,093.6729 1,923.18 111954 545 554 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% VPVIRPDVAKWELSVK R L 99.7% 41.8 25.0 13.1 41.3 0 0 2 0 2 1,836.0743 3,311.63 979871 545 560 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% VVEEAPSIFLDPETR K Q 99.7% 91.9 27.6 17.0 83.6 0 3 1 0 2 1,701.8695 3,570.32 146021 295 309 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% VYAEDPYKSFGLPSIGR R L 99.7% 46.0 26.9 17.5 34.9 0 0 5 0 2 1,898.9648 3,478.75 1319610 396 412 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% YSSAGTVEFLVDSQK K N 99.7% 113 25.8 16.7 109 0 5 0 0 2 1,630.7959 3,354.01 74,276.5 325 339 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2 Q91ZA3 Pcca uniprot_Mus-musculus_SP.fasta 79,921.9 100.0% 42 54 122 0.484% 57.2% YSSAGTVEFLVDSQKNFYFLEMNTR K L 99.7% 50.7 27.6 0.000 44.6 0 0 1 0 2 2,962.3928 4,628.69 6,495.90 325 349 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.8% 1 1 4 0.0159% 5.22% AQYEDIAQK K S 99.7% 61.1 25.0 24.3 46.7 0 4 0 0 2 1,065.5212 1,585.90 210055 343 351 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.8% 1 1 4 0.0159% 5.22% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 176 184 Empty false Q3TTY5,P04104,Q8VED5,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.8% 1 1 4 0.0159% 5.22% LLEGEECR K L 99.0% 39.5 25.0 21.0 27.8 0 2 0 0 2 1,005.4671 1,422.31 101738 472 479 Empty false Q3TTY5,Q6NXH9,Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1 Q3UV17 Krt76 uniprot_Mus-musculus_SP.fasta 62,845.6 99.8% 1 1 4 0.0159% 5.22% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 171 184 Empty false Q3TTY5,Q8VED5,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00793% 9.93% EVATNSELVQSGK R S 99.7% 89.9 27.0 14.3 87.5 0 2 0 0 2 1,361.6907 1,626.15 21,705.1 285 297 Empty false Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00793% 9.93% LASYLDKVR R A 99.7% 46.5 25.0 0.000 25.4 0 2 0 0 2 1,064.6099 2,146.93 95,280.5 95 103 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00793% 9.93% TRLEQEIATYR K R 99.2% 39.0 25.8 0.000 39.0 0 1 0 0 2 1,379.7278 2,571.25 24,677.0 375 385 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00793% 9.93% TRLEQEIATYRR K L 99.7% 35.0 26.0 17.8 25.7 0 0 2 0 2 1,535.8289 2,352.12 161070 375 386 Empty false Q9Z2K1,Q61781,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3 Q9QWL7 Krt17 uniprot_Mus-musculus_SP.fasta 48,162.9 100.0% 1 1 2 0.00793% 9.93% VLDELTLAR R A 99.7% 48.7 25.5 15.8 39.7 0 2 0 0 2 1,029.5940 2,885.41 92,265.3 193 201 Empty false Q61781,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 25.2% 0 0 0 0.000% 7.96% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 163 171 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 25.2% 0 0 0 0.000% 7.96% LLEGEECR K L 99.0% 39.5 25.0 21.0 27.8 0 2 0 0 2 1,005.4671 1,422.31 101738 457 464 Empty false Q3TTY5,Q3UV17,Q6NXH9,Q922U2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 25.2% 0 0 0 0.000% 7.96% SLDLDSIIAEVK R A 99.7% 100 25.7 27.7 85.8 0 4 1 0 2 1,302.7153 4,379.83 170474 316 327 Empty false Q922U2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 25.2% 0 0 0 0.000% 7.96% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 158 171 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3 P50446 Krt6a uniprot_Mus-musculus_SP.fasta 59,336.7 25.2% 0 0 0 0.000% 7.96% VRTEEREQIK R T 95.6% 22.5 26.4 26.0 0.000 0 0 1 0 2 1,287.7016 786.920 70,447.8 148 157 Empty false Q8VED5,Q922U2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Stress-70 protein, mitochondrial OS=Mus musculus OX=10090 GN=Hspa9 PE=1 SV=3 P38647 Hspa9 uniprot_Mus-musculus_SP.fasta 73,462.1 98.0% 1 1 1 0.00396% 1.91% AQFEGIVTDLIKR R T 99.4% 26.8 25.0 16.2 24.5 0 0 1 0 2 1,489.8375 3,822.78 36,457.5 349 361 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2 P56564 Slc1a3 uniprot_Mus-musculus_SP.fasta 59,624.2 99.1% 1 2 7 0.0278% 2.76% IVQVTAADAFLDLIR K N 99.7% 58.4 25.0 14.9 53.6 0 4 3 0 2 1,644.9321 4,987.51 48,306.5 161 175 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Isocitrate dehydrogenase [NADP], mitochondrial OS=Mus musculus OX=10090 GN=Idh2 PE=1 SV=3 P54071 Idh2 uniprot_Mus-musculus_SP.fasta 50,907.2 99.7% 1 1 2 0.00793% 3.76% GRPTSTNPIASIFAWTR K G 99.6% 28.6 27.2 14.4 28.6 0 0 2 0 2 1,874.9872 4,428.22 29,697.8 361 377 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 4 0.0159% 6.69% EAYPGDVFYLHSR R L 98.6% 38.3 25.6 0.000 38.3 0 1 0 0 2 1,553.7383 3,068.49 12,514.7 335 347 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 4 0.0159% 6.69% HALIIYDDLSK K Q 95.0% 30.6 26.7 0.000 30.6 0 1 0 0 2 1,287.6945 2,886.89 29,190.4 306 316 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1a PE=1 SV=1 Q03265 Atp5f1a uniprot_Mus-musculus_SP.fasta 59,754.1 100.0% 3 3 4 0.0159% 6.69% TSIAIDTIINQKR K F 97.1% 22.5 25.0 13.1 21.1 0 0 2 0 2 1,472.8433 2,991.53 49,066.3 219 231 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 4 0.0159% 15.2% ATDLLLDDSLVSLFGNRR K L 99.7% 29.7 26.3 19.9 22.5 0 0 3 0 2 2,005.0715 4,676.87 64,233.3 156 173 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Peroxiredoxin-5, mitochondrial OS=Mus musculus OX=10090 GN=Prdx5 PE=1 SV=2 P99029 Prdx5 uniprot_Mus-musculus_SP.fasta 21,897.6 100.0% 2 2 4 0.0159% 15.2% THLPGFVEQAGALK K A 97.1% 20.9 25.0 13.2 18.6 0 0 1 0 2 1,467.7956 2,969.46 23,858.4 99 112 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Histone H2A type 1-B OS=Mus musculus OX=10090 GN=Hist1h2ab PE=1 SV=1 C0HKE1,C0HKE2,C0HKE3,C0HKE4,C0HKE5,C0HKE6,C0HKE7,C0HKE8,C0HKE9,Q8BFU2,Q8CGP5,Q8CGP6,Q8CGP7,Q8R1M2 H2afj,Hist1h2ab,Hist1h2ac,Hist1h2ad,Hist1h2ae,Hist1h2af,Hist1h2ag,Hist1h2ah,Hist1h2ai,Hist1h2ak,Hist1h2an,Hist1h2ao,Hist1h2ap,Hist3h2a uniprot_Mus-musculus_SP.fasta 14,136.1 85.8% 1 1 1 0.00396% 22.3% VGAGAPVYLAAVLEYLTAEILELAGNAAR R D 95.3% 17.6 25.0 0.000 16.9 0 0 1 0 2 2,915.5878 6,675.41 1,818.00 44 72 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Oxct1 PE=1 SV=1 Q9D0K2 Oxct1 uniprot_Mus-musculus_SP.fasta 55,990.2 96.5% 1 1 1 0.00396% 2.12% DGSVAIASKPR K E 98.9% 37.5 25.7 26.1 32.2 0 1 0 0 2 1,100.6059 1,178.83 13,899.3 177 187 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glutamine synthetase OS=Mus musculus OX=10090 GN=Glul PE=1 SV=6 P15105 Glul uniprot_Mus-musculus_SP.fasta 42,120.0 100.0% 1 1 2 0.00793% 2.68% ATSASSHLNK M G 99.0% 43.8 25.0 18.3 39.2 0 2 0 0 1 1,057.5272 1,195.77 59,475.9 2 11 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Rab GDP dissociation inhibitor alpha OS=Mus musculus OX=10090 GN=Gdi1 PE=1 SV=3 P50396 Gdi1 uniprot_Mus-musculus_SP.fasta 50,523.1 99.1% 1 1 1 0.00396% 4.47% KFDLGQDVIDFTGHALALYR R T 99.7% 49.8 27.3 0.000 49.8 0 0 1 0 2 2,279.1822 4,983.53 7,627.80 174 193 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 5 5 8 0.0317% 13.0% FTQAGSEVSALLGR R I 99.7% 53.4 25.7 0.000 49.6 0 1 0 0 2 1,435.7540 3,446.38 33,381.5 311 324 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 5 5 8 0.0317% 13.0% IGLFGGAGVGK K T 99.5% 41.3 25.0 35.8 26.3 0 2 0 0 2 975.5624 2,991.50 57,738.5 202 212 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 5 5 8 0.0317% 13.0% IMDPNIVGNEHYDVAR R G 99.7% 29.2 25.8 13.3 27.4 0 0 2 0 2 1,858.8754 2,465.95 67,684.3 407 422 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 5 5 8 0.0317% 13.0% LVLEVAQHLGESTVR R T 99.3% 25.3 25.0 15.0 24.6 0 0 1 0 2 1,650.9174 3,221.10 37,467.9 95 109 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ATP synthase subunit beta, mitochondrial OS=Mus musculus OX=10090 GN=Atp5f1b PE=1 SV=2 P56480 Atp5f1b uniprot_Mus-musculus_SP.fasta 56,301.2 100.0% 5 5 8 0.0317% 13.0% TVLIMELINNVAK K A 99.7% 69.8 25.0 13.1 68.3 0 2 0 0 2 1,457.8397 4,997.20 14,917.5 213 225 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 6 12 0.0476% 8.88% EVATNSELVQSGK R S 99.7% 89.9 27.0 14.3 87.5 0 2 0 0 2 1,361.6907 1,626.15 21,705.1 322 334 Empty true Q9QWL7 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 6 12 0.0476% 8.88% TRLEQEIATYR K R 99.2% 39.0 25.8 0.000 39.0 0 1 0 0 2 1,379.7278 2,571.25 24,677.0 412 422 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 6 12 0.0476% 8.88% TRLEQEIATYRR K L 99.7% 35.0 26.0 17.8 25.7 0 0 2 0 2 1,535.8289 2,352.12 161070 412 423 Empty true Q9Z2K1,Q9QWL7,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 6 12 0.0476% 8.88% VLDELTLAR R A 99.7% 48.7 25.5 15.8 39.7 0 2 0 0 2 1,029.5940 2,885.41 92,265.3 230 238 Empty true Q9QWL7,Q6IFX2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2 Q61781 Krt14 uniprot_Mus-musculus_SP.fasta 52,868.1 100.0% 5 6 12 0.0476% 8.88% VTMQNLNDR K L 99.7% 79.4 25.1 26.6 0.000 0 5 0 0 2 1,106.5260 1,042.01 198117 123 131 Empty true Q9Z2K1,P02535 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 5 0.0198% 7.11% EGSSIGAIDSR R L 98.5% 34.9 25.2 17.2 13.8 0 1 0 0 2 1,091.5328 1,714.14 148219 223 233 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 5 0.0198% 7.11% IVPNILLEQGK K A 99.7% 52.3 25.0 0.000 48.8 0 2 0 0 2 1,223.7360 3,187.50 79,601.6 383 393 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Citrate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Cs PE=1 SV=1 Q9CZU6 Cs uniprot_Mus-musculus_SP.fasta 51,738.1 100.0% 3 3 5 0.0198% 7.11% VVPGYGHAVLR R K 99.7% 47.2 25.0 13.2 42.6 0 2 0 0 2 1,167.6633 2,055.86 95,912.4 341 351 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 93.5% 1 1 1 0.00396% 16.0% AILVDLEPGTMDSVR R S 99.7% 60.6 27.0 16.5 53.2 0 2 0 0 2 1,631.8312 3,241.29 33,142.5 63 77 Empty false P99024,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 93.5% 1 1 1 0.00396% 16.0% GHYTEGAELVDSVLDVVRK K E 99.7% 47.3 27.6 14.9 47.1 0 0 2 0 2 2,087.0769 4,249.08 70,314.2 104 122 Empty false P99024,Q922F4,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 93.5% 1 1 1 0.00396% 16.0% LAVNMVPFPR K L 99.7% 67.2 26.7 21.8 54.2 0 2 0 0 2 1,159.6293 3,018.66 104212 253 262 Empty false P99024,Q922F4,Q9D6F9,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 93.5% 1 1 1 0.00396% 16.0% MREIVHIQAGQCGNQIGAK - F 99.7% 32.8 27.5 14.7 0.000 0 0 1 0 2 2,126.0596 2,005.22 11,923.4 1 19 Empty false P99024,Q9D6F9,P68372,Q7TMM9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Tubulin beta-3 chain OS=Mus musculus OX=10090 GN=Tubb3 PE=1 SV=1 Q9ERD7 Tubb3 uniprot_Mus-musculus_SP.fasta 50,418.7 93.5% 1 1 1 0.00396% 16.0% YLTVATVFR R G 98.0% 33.7 25.0 0.000 33.2 0 1 0 0 2 1,069.6040 3,469.86 23,015.0 310 318 Empty true Q922F4 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 2 2 2 0.00793% 8.24% LLVSASQDGK R L 98.3% 40.1 26.4 22.7 31.2 0 1 0 0 2 1,017.5576 1,620.50 31,470.4 69 78 Empty true P62880 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus OX=10090 GN=Gnb1 PE=1 SV=3 P62874 Gnb1 uniprot_Mus-musculus_SP.fasta 37,377.5 100.0% 2 2 2 0.00793% 8.24% SELDQLRQEAEQLKNQIR M D 99.7% 40.5 26.9 15.2 39.8 0 0 1 0 1 2,240.1632 4,232.38 36,210.0 2 19 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 7 0.0278% 8.22% MHDSHLSSDEPK R H 99.7% 35.9 25.0 14.5 22.8 0 0 2 0 2 1,398.5956 785.093 91,694.4 18 29 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 7 0.0278% 8.22% MQEDIEMTK R T 99.7% 49.3 25.0 22.4 37.0 0 3 0 0 2 1,156.4863 1,043.62 33,791.6 509 517 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 7 0.0278% 8.22% NDEVSSLDAFLDLIR K N 99.7% 52.6 26.8 13.1 48.3 0 1 0 0 2 1,706.8597 5,255.43 3,234.80 159 173 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Excitatory amino acid transporter 2 OS=Mus musculus OX=10090 GN=Slc1a2 PE=1 SV=1 P43006 Slc1a2 uniprot_Mus-musculus_SP.fasta 62,032.3 100.0% 4 4 7 0.0278% 8.22% SELDTIDSQHR K M 99.4% 41.1 25.0 22.3 37.7 0 1 0 0 2 1,300.6129 1,768.63 13,222.5 498 508 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 5 16 0.0634% 5.97% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 199 207 Empty false Q3TTY5,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 5 16 0.0634% 5.97% FLEQQNQVLQTK R W 99.7% 73.1 26.1 23.2 61.0 0 4 0 0 2 1,475.7854 2,391.38 137523 208 219 Empty true Q6NXH9,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 5 16 0.0634% 5.97% SLNDKFASFIDKVR K F 99.0% 40.4 25.9 15.9 0.000 0 0 1 0 2 1,640.8644 4,054.48 16,346.1 194 207 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 5 16 0.0634% 5.97% TNAENEFVTIK R K 99.7% 54.3 25.6 13.3 51.7 0 2 0 0 2 1,265.6372 2,566.74 125833 286 296 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1 OS=Mus musculus OX=10090 GN=Krt1 PE=1 SV=4 P04104 Krt1 uniprot_Mus-musculus_SP.fasta 65,607.1 100.0% 4 5 16 0.0634% 5.97% TNAENEFVTIKK R D 99.7% 80.2 25.7 13.7 66.9 0 5 4 0 2 1,393.7322 2,087.47 1490180 286 297 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium- and chloride-dependent GABA transporter 3 OS=Mus musculus OX=10090 GN=Slc6a11 PE=1 SV=2 P31650 Slc6a11 uniprot_Mus-musculus_SP.fasta 69,963.1 99.3% 1 1 2 0.00793% 2.55% GSETLGGGGGGAAGTR R E 99.7% 54.2 25.0 15.3 49.0 0 2 0 0 2 1,304.6192 1,151.80 16,991.3 20 35 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Suclg1 PE=1 SV=4 Q9WUM5 Suclg1 uniprot_Mus-musculus_SP.fasta 36,155.2 86.3% 1 1 1 0.00396% 4.62% LIGPNCPGVINPGECK R I 95.5% 30.7 26.2 13.2 30.7 0 1 0 0 2 1,724.8462 2,648.90 6,939.60 167 182 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Synaptic vesicle glycoprotein 2A OS=Mus musculus OX=10090 GN=Sv2a PE=1 SV=1 Q9JIS5 Sv2a uniprot_Mus-musculus_SP.fasta 82,648.9 93.7% 1 1 1 0.00396% 2.43% GGLSDGEGPPGGRGEAQR R R 98.1% 30.2 25.2 14.0 30.2 0 0 1 0 2 1,696.8001 1,367.82 29,575.8 124 141 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 99.3% 1 1 2 0.00793% 15.4% GAWSNVLR K G 99.0% 54.2 27.4 30.5 16.7 0 2 0 0 2 902.4842 2,777.65 70,484.0 273 280 Empty false P48962 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 99.3% 1 1 2 0.00793% 15.4% GMGGAFVLVLYDEIKK R Y 99.7% 38.8 25.8 15.8 38.8 0 0 3 0 2 1,755.9353 4,396.26 106450 281 296 Empty false P48962 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) ADP/ATP translocase 2 OS=Mus musculus OX=10090 GN=Slc25a5 PE=1 SV=3 P51881 Slc25a5 uniprot_Mus-musculus_SP.fasta 32,932.6 99.3% 1 1 2 0.00793% 15.4% TDAAVSFAKDFLAGGVAAAISK M T 99.7% 63.5 26.7 19.4 60.9 0 0 2 0 1 2,152.1286 5,584.17 11,032.7 2 23 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus OX=10090 GN=Ndufs1 PE=1 SV=2 Q91VD9 Ndufs1 uniprot_Mus-musculus_SP.fasta 79,777.6 97.9% 1 1 2 0.00793% 1.24% ILQDIASGR K H 99.4% 49.5 25.0 16.9 21.3 0 2 0 0 2 972.5474 2,036.39 100522 451 459 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 2 2 4 0.0159% 4.58% IQEVDAQMLR R D 99.7% 56.8 26.0 29.3 44.3 0 3 0 0 2 1,218.6149 2,017.81 73,230.1 433 442 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2 Q9CZ13 Uqcrc1 uniprot_Mus-musculus_SP.fasta 52,851.9 100.0% 2 2 4 0.0159% 4.58% LCTSATESEVTR R G 97.6% 41.0 25.0 18.8 35.4 0 1 0 0 2 1,353.6315 1,654.71 13,495.4 379 390 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 2 2 4 0.0159% 14.8% IQFNESFAEMNR R G 99.7% 75.9 25.0 13.5 74.2 0 2 0 0 2 1,501.6740 2,784.33 30,219.4 84 95 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Mus musculus OX=10090 GN=Cox4i1 PE=1 SV=2 P19783 Cox4i1 uniprot_Mus-musculus_SP.fasta 19,531.0 100.0% 2 2 4 0.0159% 14.8% SEDYAFPTYADRR K D 96.6% 20.3 25.0 14.0 18.9 0 0 2 0 2 1,590.7183 2,523.77 95,582.4 30 42 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 99.1% 1 1 2 0.00793% 8.39% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 178 186 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 99.1% 1 1 2 0.00793% 8.39% FLEQQNQVLQTK R W 99.7% 73.1 26.1 23.2 61.0 0 4 0 0 2 1,475.7854 2,391.38 137523 187 198 Empty false P04104,Q6NXH9 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 99.1% 1 1 2 0.00793% 8.39% FLEQQNQVLQTKWELLQQVNTSTR R T 99.7% 74.1 27.4 15.4 17.0 0 0 2 0 2 2,932.5166 3,975.60 64,622.8 187 210 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 99.1% 1 1 2 0.00793% 8.39% NKYEDEINKR K T 99.7% 46.8 25.1 18.0 35.5 0 1 4 0 2 1,308.6543 1,397.23 163114 255 264 Empty false Q8VED5,Q922U2 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1 Q6IFZ6 Krt77 uniprot_Mus-musculus_SP.fasta 61,359.9 99.1% 1 1 2 0.00793% 8.39% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 173 186 Empty false Q3TTY5,Q8VED5,Q3UV17,Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 6 0.0238% 13.6% DSYVGDEAQSKR K G 99.7% 47.8 25.0 13.1 47.8 0 2 0 0 2 1,354.6234 1,204.75 18,553.5 51 62 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 6 0.0238% 13.6% GYSFTTTAER R E 96.7% 41.0 25.0 0.000 40.0 0 1 0 0 2 1,132.5269 2,114.40 29,724.2 197 206 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 6 0.0238% 13.6% QEYDESGPSIVHR K K 97.6% 22.0 25.0 0.000 22.0 0 0 1 0 2 1,516.7027 1,894.79 26,019.0 360 372 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1 P60710,P63260 Actb,Actg1 uniprot_Mus-musculus_SP.fasta 41,737.8 100.0% 4 4 6 0.0238% 13.6% SYELPDGQVITIGNER K F 99.7% 59.8 27.7 13.4 52.4 0 2 0 0 2 1,790.8921 3,612.27 41,013.3 239 254 Empty true Q8BFZ3 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% ALEEANADLEVK R I 99.7% 69.9 26.3 23.3 14.8 0 2 0 0 2 1,301.6584 2,260.56 113859 114 125 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% DAEEWFFTKTEELNR K E 99.7% 31.8 25.0 0.000 31.0 0 0 2 0 2 1,914.8869 3,861.87 56,282.1 280 294 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% TKYETELNLR R M 98.1% 36.2 25.0 15.4 36.2 0 2 0 0 2 1,266.6689 2,177.89 90,320.9 181 190 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% TRLEQEIATYR K R 99.2% 39.0 25.8 0.000 39.0 0 1 0 0 2 1,379.7278 2,571.25 24,677.0 385 395 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% TRLEQEIATYRR K L 99.7% 35.0 26.0 17.8 25.7 0 0 2 0 2 1,535.8289 2,352.12 161070 385 396 Empty false Q9Z2K1,Q9QWL7,Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type I cytoskeletal 42 OS=Mus musculus OX=10090 GN=Krt42 PE=1 SV=1 Q6IFX2 Krt42 uniprot_Mus-musculus_SP.fasta 50,133.6 100.0% 3 3 6 0.0238% 12.8% VLDELTLAR R A 99.7% 48.7 25.5 15.8 39.7 0 2 0 0 2 1,029.5940 2,885.41 92,265.3 203 211 Empty false Q9QWL7,Q61781 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3 Q02257 Jup uniprot_Mus-musculus_SP.fasta 81,801.9 99.4% 1 1 2 0.00793% 2.42% TLVTQNSGVEALIHAILR K A 99.7% 39.2 25.0 13.2 36.8 0 0 2 0 2 1,935.1023 5,103.17 16,662.6 427 444 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 210 218 Empty false P04104,Q8VED5,Q3UV17,Q6NXH9,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% GFSSGSAVVSGGSR R R 99.7% 106 25.0 18.6 92.6 0 2 0 0 2 1,254.6072 1,772.35 145036 23 36 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% KYEDEINKR K T 99.7% 48.4 25.0 20.3 40.1 0 1 0 0 2 1,194.6114 1,056.15 8,175.20 288 296 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% LLEGEECR K M 99.0% 39.5 25.0 21.0 27.8 0 2 0 0 2 1,005.4671 1,422.31 101738 504 511 Empty false Q3UV17,Q6NXH9,Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% LLRDYQELMNTK R L 98.0% 23.6 26.0 19.7 18.1 0 0 3 0 2 1,523.7888 2,897.02 168345 480 491 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 2 epidermal OS=Mus musculus OX=10090 GN=Krt2 PE=1 SV=1 Q3TTY5 Krt2 uniprot_Mus-musculus_SP.fasta 70,923.6 100.0% 3 4 6 0.0238% 8.06% TLNNKFASFIDKVR K F 99.7% 66.8 25.0 17.6 62.9 0 0 1 0 2 1,652.9119 3,301.77 196940 205 218 Empty false Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% AYNMLDIIHAVIDER K E 99.7% 31.1 27.3 13.7 21.7 0 0 2 0 2 1,772.9001 5,158.63 13,613.2 315 329 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% FANPFPAAVR K G 95.1% 32.7 27.0 15.0 25.1 0 1 0 0 2 1,089.5839 3,119.18 39,615.7 492 501 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% GAVEIIFK K G 99.0% 43.8 25.0 21.9 15.6 0 2 0 0 2 876.5190 3,077.77 47,636.6 469 476 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% HLLGDTNYAWPTAEIAVMGAK K G 99.7% 43.1 28.0 14.5 39.7 0 0 1 0 2 2,274.1226 3,671.79 23,397.0 448 468 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% IQEGVESLAGYADIFLR R N 99.7% 51.0 26.7 15.9 47.5 0 0 2 0 2 1,880.9754 4,864.56 17,041.2 168 184 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% LLYAFAEATVPK K I 99.7% 60.5 25.0 13.3 56.1 0 2 0 0 2 1,322.7355 3,549.77 170164 417 428 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% LVPELDTVVPLESSK R A 99.7% 57.7 25.0 13.6 57.1 0 2 0 0 2 1,625.8998 3,644.42 65,701.7 300 314 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% LVYVFSQDFTVFGGSLSGAHAQK R I 99.7% 38.7 28.2 14.3 36.0 0 0 1 0 2 2,458.2402 4,341.95 23,026.3 120 142 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% NIVVGFAR K M 98.4% 34.8 25.0 14.4 34.8 0 1 0 0 2 875.5097 2,660.98 45,343.3 341 348 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% SVTNEDVTQEQLGGAK K T 99.7% 111 26.7 18.1 92.0 0 2 0 0 2 1,675.8135 1,986.56 37,302.9 235 250 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Propionyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Pccb PE=1 SV=2 Q99MN9 Pccb uniprot_Mus-musculus_SP.fasta 58,409.5 100.0% 11 11 18 0.0714% 31.1% TVGIVGNQPNVASGCLDINSSVK R G 99.7% 40.1 28.1 0.000 40.1 0 0 2 0 2 2,329.1818 3,147.88 46,005.5 353 375 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gpd2 PE=1 SV=2 Q64521 Gpd2 uniprot_Mus-musculus_SP.fasta 80,955.1 99.5% 1 1 1 0.00396% 2.34% LVQDYGLESEVAQHLAK R T 96.4% 23.7 26.9 13.1 20.3 0 0 1 0 2 1,899.9812 3,417.55 47,517.1 483 499 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hadh PE=1 SV=2 Q61425 Hadh uniprot_Mus-musculus_SP.fasta 34,464.7 99.1% 1 1 1 0.00396% 3.50% LLVPYLIEAVR R L 99.7% 46.5 25.0 14.4 44.4 0 1 0 0 2 1,285.7879 4,501.89 12,959.3 222 232 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Aldehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh2 PE=1 SV=1 P47738 Aldh2 uniprot_Mus-musculus_SP.fasta 56,537.6 99.8% 1 1 1 0.00396% 2.70% TFVQENVYDEFVER R S 99.5% 41.9 25.2 0.000 41.9 0 1 0 0 2 1,774.8282 3,718.93 10,562.6 327 340 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Sodium/potassium-transporting ATPase subunit beta-1 OS=Mus musculus OX=10090 GN=Atp1b1 PE=1 SV=1 P14094 Atp1b1 uniprot_Mus-musculus_SP.fasta 35,196.4 100.0% 1 1 2 0.00793% 3.62% SYEAYVLNIIR K F 99.7% 60.9 25.0 16.0 51.2 0 2 0 0 2 1,340.7208 4,162.99 63,897.5 97 107 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 2 2 4 0.0159% 13.1% IETELRDICNDVLSLLEK K F 99.7% 33.6 27.4 16.0 29.1 0 0 3 0 2 2,160.1220 5,236.49 21,030.1 86 103 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1 P63101 Ywhaz uniprot_Mus-musculus_SP.fasta 27,771.9 100.0% 2 2 4 0.0159% 13.1% SVTEQGAELSNEER K N 99.7% 89.6 25.0 16.4 88.3 0 1 0 0 2 1,548.7136 1,783.37 8,931.00 28 41 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.6% 1 1 1 0.00396% 9.28% FASFIDKVR K F 99.6% 44.0 25.0 13.1 0.000 0 1 0 0 2 1,082.5993 2,701.91 80,301.1 142 150 Empty false Q3TTY5,P04104,Q8VED5,Q3UV17,Q922U2,Q6IFZ6,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.6% 1 1 1 0.00396% 9.28% FLEQQNQVLQTK R W 99.7% 73.1 26.1 23.2 61.0 0 4 0 0 2 1,475.7854 2,391.38 137523 151 162 Empty false P04104,Q6IFZ6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.6% 1 1 1 0.00396% 9.28% LALDIEIATYR K K 99.7% 63.3 25.0 0.000 58.8 0 2 0 0 2 1,277.7101 3,789.01 94,548.6 424 434 Empty false Q9Z2T6 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.6% 1 1 1 0.00396% 9.28% LLEGEECR K M 99.0% 39.5 25.0 21.0 27.8 0 2 0 0 2 1,005.4671 1,422.31 101738 436 443 Empty false Q3TTY5,Q3UV17,Q922U2,P50446 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Keratin, type II cytoskeletal 73 OS=Mus musculus OX=10090 GN=Krt73 PE=1 SV=1 Q6NXH9 Krt73 uniprot_Mus-musculus_SP.fasta 58,912.8 99.6% 1 1 1 0.00396% 9.28% VRAQEREQIK K A 99.2% 26.7 26.0 27.7 9.22 0 0 1 0 2 1,257.6911 788.847 29,029.9 127 136 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus OX=10090 GN=Hnrnpk PE=1 SV=1 P61979 Hnrnpk uniprot_Mus-musculus_SP.fasta 50,978.5 98.9% 1 1 1 0.00396% 3.67% ILSISADIETIGEILKK R I 99.7% 26.4 25.0 14.7 26.4 0 0 1 0 2 1,843.0790 5,075.09 4,907.00 87 103 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 9 0.0357% 9.80% LKYPLEEFTTDNQQEEAR R C 99.7% 65.2 27.2 0.000 57.8 0 0 6 0 2 2,211.0566 3,153.32 118215 251 268 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 9 0.0357% 9.80% NLLLAEVINIIK K R 99.7% 53.0 25.0 14.3 53.0 0 1 0 0 2 1,352.8513 5,453.12 7,504.50 389 400 Empty true 22-2895 18 18 20220411_bbm1840_22-2895_Killinger_18 (F006912) 4-aminobutyrate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Abat PE=1 SV=1 P61922 Abat uniprot_Mus-musculus_SP.fasta 56,453.9 100.0% 3 3 9 0.0357% 9.80% TLLTGLLDLQAQYPQFISR K V 99.7% 37.4 25.0 14.4 33.1 0 0 2 0 2 2,177.1968 5,025.75 14,000.2 414 432 Empty true END OF FILE