Supplementary Material File 1. The information of 20 conserved motifs of Cellulose synthase genes in Phaseolus vulgaris detected by the online tool MEME.

Motif 1 PRLVYVSREKRPGYQHHKKAGAMNALVRVSAVLSNAPFILNLDCDHYVNN  width =  50  sites =  39  llr = 4538  E-value = 1.2e-1490

Motif 2 VISCGYEDKTEWGKEVGWIYGSVTEDVLTGFKMHCRGWRSVYCMPKRPAF  width =  50  sites =  38  llr = 4091  E-value = 1.1e-1281

Motif 3 NTVLSILAVDYPVEKLSCYVSDDGASMLTFEALAEASEFARKWVPFCKKY  width =  50  sites =  35  llr = 3943  E-value = 4.4e-1244

Motif 4 IEEWWRNZQFWVIGGTSAHLF width =  21  sites =  38  llr = 1540  E-value = 4.8e-386

Motif 5 VACNECGFPVCRPCYEYERREGNQVCPQCKTRY width =  33  sites =  18  llr = 1432  E-value = 9.5e-383

Motif 6 CYVQFPQRFDGIDKND width =  16  sites =  39  llr = 1340  E-value = 1.2e-344

Motif 7 DINMKGLDGJQGPVYVGTGCVFRRQALYG width =  29  sites =  39  llr = 2200  E-value = 1.4e-605

Motif 8 IEPRAPEWYFSQKIDYLKDKVQPTFVKERRAMKREYEEFKV width =  41  sites =  21  llr = 2110  E-value = 1.3e-609

Motif 9 SDAINSGYQSWGPLFGKLFFSFWVIVHLYPFLKGLMGRQNRTPTIVVVWS  width =  50  sites =  21  llr = 2465  E-value = 1.5e-704 

Motif 10 INALVAKAQKVPEEGWTMQDGTPWPGNNTRDHPGMIQVFLG width =  41  sites =  15  llr = 1634  E-value = 2.3e-464

Motif 11 ICEIWFAFSWILDQFPKWFPINRETYLDRLS  width =  31  sites =  34  llr = 2021  E-value = 6.0e-532

Motif 12 APINLSDRLHQVLRWALGSVE  width =  21  sites =  36  llr = 1535  E-value = 2.7e-396

Motif 13 LPPVDIFVSTADPVKEPPLIT  width =  21  sites =  35  llr = 1567  E-value = 4.2e-417

Motif 14 SKAVREAMCFLMDPQ width =  15  sites =  39  llr = 1205  E-value = 8.7e-292

Motif 15 IJPALCLLTGKFIFPKJSNLAS width =  22  sites =  38  llr = 1293  E-value = 3.3e-256